KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PF00467Help
Entry
REMIM1_PF00467    CDS       T02778                                 

Definition
(GenBank) type VI protein secretion system FHA domain-containing protein
  KO
K11894  type VI secretion system protein ImpI
Organism
rel  Rhizobium etli bv. mimosae Mim1
Brite
KEGG Orthology (KO) [BR:rel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rel02044]
    REMIM1_PF00467
Secretion system [BR:rel02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   REMIM1_PF00467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA Yop-YscD_cpl
Motif
Other DBs
NCBI-ProteinID: AGS26132
UniProt: S5SW95
Position
pRetMIM1f:complement(497489..498673)
Genome map
AA seq 394 aa AA seqDB search
MRLELREITSDVAMPAGRSKWFFERGRRTLGRAPDCDWRLPEDRRSISKLHCIIERDRDG
FLLRDQSANGSRVDGVTVHEGEIARLSDRSRLEMGGLAFSVHISGSSDQEIEDPDAGLML
SDEPLTISAILADIAPGGRTASGILGERIADDWTLPEQGGRKGAASSRNVEIGWSGPPET
RSVTQLLPEDWNSDETDYGSHLEHGSATHVSVPIAQRRPAAIEIVNDNDPRPEAEAFPTL
TIGRPEAFADRLEPLLARLEEAVEGAYAIFDMNAPRSGPELDFLAGREEALLGRIETLLA
QQLKLNVALEALVHAAGRLEPRIVEAQVETGAWGLPWRRDRNYWQAYRAEFEKDGKSRSI
QDVFRDAMSDAVNGRKAGPRPQDGQEGKDAHHEE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcgaactgagagagatcaccagcgacgtggcaatgccggccggacgatcgaaa
tggttcttcgaacgcggccggcgcacgctcggccgggcgcccgattgcgactggcggctg
ccggaggaccggcgctcgatttcgaagctgcattgcatcattgagcgcgaccgtgatggc
ttcctgctgcgcgaccagagcgccaacggctcccgggtcgatggcgtcaccgtgcatgaa
ggcgagatcgcaagactttccgaccggtcgcggctggagatgggcgggcttgccttctca
gttcacatctcaggcagtagcgaccaggaaatcgaagatcccgatgccggtctcatgctc
agcgacgaacctctgaccatttccgcgatcctcgccgacatcgccccgggcggccggacc
gcaagcggcattctcggcgagcgcatcgccgatgactggacactgcccgaacagggcggc
aggaaaggcgcggcttcctcccgaaatgtcgagatcggctggagcgggcctccggagacc
cgctcggtcacccagcttctgccggaggactggaattccgacgagaccgattacggcagc
cacctcgaacatggttcagccacccacgtttccgtgccgatcgcgcagcgccggccagcg
gcgatcgaaatcgtcaacgacaatgatccccgacccgaagccgaggcgtttccgaccctg
acgatcggccggccggaggcctttgcggatcgtctggagccgctgcttgcccggctggaa
gaggcagtcgagggtgcctatgccatcttcgacatgaacgcgccgcgctccggcccggag
ctggatttcctggccggccgggaggaggcgcttctcggacgcatcgagaccctgctcgcg
cagcaactcaaactcaatgtcgccctcgaggcccttgtccacgcggcgggacggctggag
ccgcgcatcgtcgaggcgcaggtcgagaccggcgcctggggcctgccctggcgccgcgac
cggaactattggcaggcctacagggcagaattcgaaaaggacggcaagagccggtcgatc
caggatgttttccgcgacgcgatgtcagatgcggtgaacggcagaaaggcagggcctcgt
ccgcaagacgggcaggaaggaaaagacgcgcatcatgaggaatga

DBGET integrated database retrieval system