KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PF00472
Entry
REMIM1_PF00472    CDS       T02778                                 

Definition
(GenBank) type VI secretion system-associated protein
  KO
K11899  type VI secretion system protein ImpD
Organism
rel  Rhizobium etli bv. mimosae Mim1
Brite
KEGG Orthology (KO) [BR:rel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rel02044]
    REMIM1_PF00472
Secretion system [BR:rel02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   REMIM1_PF00472
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AGS26137
UniProt: S5SWA0
Position
pRetMIM1f:complement(502809..504197)
AA seq 462 aa
MGSSTEWRRRADQLITLIDEALNRQVNAILHHPDFQAMEARWRGLAMLVREASRSGEVKV
KLLSVSWRELARSMERASDFDQSHLFELIYSREFGMPGGEPFGLLVGDYHLSPADPADGD
PVSTLSQIGMVAAAAFCPFVAGAAPAAIGLEDFHELNRVNDFSWLATEADRIRWNGLRAR
EDSRFLGLAAPRILMRSPLTPHARDRNDGFPFRESIAADGSSLLWGNAAFAFATVVIRNF
INSGWFADIRGVTQDAVDGGLLSAAELPPYDFGTESNGLSAQAPVEIHLTSSQEQQLCEL
GIIPAATTYLSSSAIFNSNQSLHAPPHYSNEHARQNARLAAMLQYVLCASRFSHYLKVIM
RDEIGQLSDAISIERKLMDWLTAYTLGNDDADIALRTRFPLRSAGISVAEIPGKPGSFSC
TVRLQPHFQLDDVATSFHLIAETATTGQILSRPVAMPERMSA
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggttccagcactgaatggcggcgccgggcggatcagctgattacgctgatcgacgaa
gcgctgaacaggcaagtcaacgccatcctccaccatcccgattttcaggcgatggaggcg
agatggcgcggccttgccatgctcgtgcgcgaggcaagccgcagcggcgaagtcaaggtc
aagctgctcagcgtcagctggcgcgaactggcgcgcagcatggagcgcgccagcgatttc
gaccagagccatctgttcgaactgatctacagccgcgaattcggcatgccgggcggcgag
cccttcggcctcttggtcggcgactatcatctgtctccggccgatcccgccgacggcgat
ccggtcagcacgctgtcgcagatcggcatggtggccgccgccgccttctgccccttcgtc
gcgggcgctgcgccggctgcgatcgggcttgaggattttcacgaactgaaccgggtgaat
gacttctcctggcttgccaccgaggcggaccgcatccgctggaacggtcttcgcgcccgt
gaggattcgcgtttcctcgggcttgccgcgccgcgcatcctgatgcgctcgccgctcaca
ccgcatgcgcgcgatcgcaacgacggctttcccttccgcgaaagcattgccgccgacggc
agttcgctgctctggggcaatgccgcctttgccttcgcgaccgtcgtcatcaggaatttc
atcaattccggctggttcgccgatatccgcggcgtcacgcaggatgccgtcgacggcggc
ttgctgagtgcggccgaattgccgccatacgatttcggcaccgaaagcaacggcctgtca
gctcaggcgcctgtcgaaatccacctgaccagcagccaggagcagcaactctgcgagctc
ggcattatcccggcggcgaccacctatctctcgtcttcggcgattttcaattccaaccag
tcgctgcacgcgccgccgcattattccaacgaacatgcgcgccagaacgcgcggctcgcc
gccatgctgcaatatgtgctctgcgcctcgcgcttctcgcattatctcaaggtcatcatg
cgcgacgagatcggccagctctccgatgcgatctcgatcgagcgcaagctcatggactgg
ctgaccgcctatacgctcggcaacgacgacgccgatatcgcgctgcgcacccgctttccg
ctgcgctccgcaggcatcagcgtcgccgaaattccgggcaagcccggcagcttctcctgc
accgtccgcctgcagccgcatttccagctcgatgacgtcgccacgagcttccacctgatc
gccgagaccgcgaccacgggccagatcctgagccggccggtcgccatgcccgagaggatg
tccgcatga

DBGET integrated database retrieval system