KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PF00474Help
Entry
REMIM1_PF00474    CDS       T02778                                 

Definition
(GenBank) type VI secretion system-associated protein
  KO
K11901  type VI secretion system protein ImpB
Organism
rel  Rhizobium etli bv. mimosae Mim1
Brite
KEGG Orthology (KO) [BR:rel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rel02044]
    REMIM1_PF00474
Secretion system [BR:rel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   REMIM1_PF00474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA DUF4349
Motif
Other DBs
NCBI-ProteinID: AGS26139
UniProt: S5SXD4
Position
pRetMIM1f:complement(505879..506424)
Genome map
AA seq 181 aa AA seqDB search
MRRRRASMASVHEKLERVRKPRVHIKYEVETEGAMVVKELPFVVGVLGDFSGNPTQPLKA
FGERKFVQIDRDNFDDVMRRMTPGLTLSVENTLEKDGTELPVSLKFESMADFEPGAVVDQ
VPALKALLNARNQLRDLMSKADRSEELERLLEEILQNKADLSQLVAQLGGGKAGEAKDVL
N
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagacgaaggagagcctcgatggcaagtgtacatgaaaaactggaacgggttcgcaag
ccgcgggtccatatcaaatatgaagtcgaaaccgaaggcgcgatggtggtgaaggagctg
cctttcgtcgtcggcgtgctcggcgacttctccggcaatccgacacagcctctcaaggct
ttcggcgagcgcaagttcgtgcagatcgaccgcgacaatttcgacgacgtcatgcgccgg
atgacgccgggcctcacgctttcggtcgagaacactctcgagaaagacggaacggagctt
ccggtttcactgaaattcgaaagcatggccgacttcgaaccgggcgcggtcgtcgatcag
gtgccggcgctgaaggcgctgctcaacgcccgcaaccagctgcgcgacctgatgagcaag
gcggaccgctccgaggagctcgagcgcctgctcgaggagatcctgcagaacaaggccgat
ctctcgcagctggtggctcagcttggcggcggcaaggccggcgaggcgaaggacgttctg
aactga

DBGET integrated database retrieval system