KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PF00480
Entry
REMIM1_PF00480    CDS       T02778                                 

Definition
(GenBank) type VI secretion system Rhs element Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rel00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    REMIM1_PF00480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rel02044]
    REMIM1_PF00480
Secretion system [BR:rel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   REMIM1_PF00480
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: AGS26145
UniProt: S5S8B9
Position
pRetMIM1f:513253..515517
AA seq 754 aa
MDDLQSLAADFIQANRILKIVSPLGEDQLLPERVTIEEGISSLFEIKISARAKKPSVKPE
ELIGRLMDVSVEVQQGDGEGALRRPFNGLVTELNEGPPITRGLRSYSMVLRPQMWLLSRR
SDCRIWMDKTSVDIVETLFSEHGIPAPDTSGVITPPPPQHYSVQWNETDLAFLTRRFEED
GLFYWFSHEDGKHKLHVADSAQSWLGPSPSAQGEGRVRLAQGSADRNHITEWSRRYSYVP
GQRAGADWNFETPRMVPGTMTPSLVQLPEASKRELYEYPARISSVAEAERAEKLRMQASE
ADHDRVFGGSTSRILEAGRRFTPYEVAHPDHVYEEHVVVKATHTVVDRSYETNSNEPEYT
NTFEAVPSRVPMTPHRETKRPRIEGTQVAIVAGPSGEEIHPDQYGRIKLWFPWDRKAKKD
GSDTCWVRVSQVWGGGTWGAQVIPRIGMEVMVAFVDGDPDRPLVTGVVPNPSNTVPYDLP
ANKTRMVMRSNTHKGTGFNEMTFEDEAGQENMFFHAQKDQTTRVLNDRIKRVDRHEVSAI
GGNRAVEVSGNQKHEIGGSVNTVVGGTGPMAMALMGAVSGLSGHTAGLLAQAGQIAGGGG
AGLAAFAGTVASSALGFLGAGGLGSREGVVSGPSPRADAGTALAGSGTGVGDAASGLFPM
PGIMNTIVGAFKSDTIGIARAEQIGMSKVTNVGQTSLESVGKFKKIAVGEEFVIECGDSK
FIMKANGEVIILGKTFNFVATEHFQMRGKPIDLN
NT seq 2265 nt   +upstreamnt  +downstreamnt
atggacgatttgcaatcccttgccgccgacttcatccaggcgaaccgtattctgaagatc
gtctcgccgcttggcgaggaccagcttctgccggagcgggtgacgatcgaggaaggcatt
tcttcgctcttcgaaatcaagatttcggcgcgtgccaagaagccgtcggttaagccggag
gaactgatcggccggctaatggatgtctccgtggaggtgcagcagggcgatggcgaaggc
gccctgcgccggccgttcaacggcttggtgaccgaactcaacgaggggccgccgatcacc
cgcgggctgcgctcctactccatggtgctgcggccgcagatgtggctcttatcgcgccgc
tccgactgccgtatctggatggacaagacctcggtcgacatcgtcgaaacgctgttttcc
gaacatggaatcccggcacccgatacgtcgggcgtcatcacgccaccgccgccgcagcat
tattcggtgcagtggaacgaaaccgatcttgccttcctcacccgccgtttcgaagaggac
ggcctgttctactggttttcgcatgaggacggcaaacacaagctgcatgtggccgacagc
gcccaatcctggctcggcccctcgccatcggcgcagggggagggtcgggttcgcctggcg
cagggctcggccgaccgcaatcacatcaccgagtggagccggcgttattcctatgtgccg
ggccagcgcgccggcgccgactggaacttcgaaaccccacgcatggtgcccggcacgatg
accccgtctctggtgcagctgccggaagcgagcaagcgcgagctttacgaatatccggcg
cgcatctcttccgtcgccgaggcggagcgggcggagaaactgaggatgcaggcctccgag
gccgatcacgaccgggtcttcggcggctcgacatcccgcatcctggaggccggacgccgc
ttcacaccttatgaggtcgctcatcccgaccatgtctatgaggagcatgtggtggtcaag
gcgacccatacggtcgtcgaccgctcctatgagaccaacagcaacgagccggaatatacc
aataccttcgaggcggtgccgtcgcgggtgccgatgacgccgcaccgcgagacgaagcgg
ccgcgcatcgagggcacgcaggtggcgatcgtcgccggcccttccggcgaggagatccat
cccgaccaatacggccgcatcaagctgtggttcccctgggaccgcaaggccaagaaggac
ggctccgacacttgctgggtgcgggtcagccaggtctggggcggcggcacctggggcgcg
caggttatcccgcgcatcggcatggaggtgatggtcgccttcgtcgacggcgaccccgac
cggccgctggtaacaggcgtggtgcccaatcccagcaacacggttccctacgatctgcct
gccaacaagacccgcatggtcatgcgctccaacacccacaagggcaccggcttcaacgaa
atgaccttcgaggacgaggccggccaggagaacatgttcttccatgcgcagaaggaccag
acgacgcgcgtgctgaatgaccgcatcaaacgcgtcgaccggcatgaggtctcggccatc
ggtggcaaccgcgcggtggaggtgagtggcaatcagaagcacgagatcggcggttcggtg
aacacggtcgtcggcggcaccgggccgatggcgatggcgctgatgggggcggtcagtggt
ctctccggacataccgccgggctcctggcccaggccgggcaaattgcaggcggcggcggg
gcagggcttgcggccttcgccggcacggttgcgtcttcggcgctcggctttctcggcgct
ggcgggctgggcagccgtgagggcgtggtgtcgggaccgtcgccaagagcggatgcgggc
acggcgcttgccggttccggcacgggtgttggcgatgcggcttcgggccttttcccaatg
cccggcatcatgaacacaatcgtcggcgccttcaaatccgacacgatcggcattgcccgc
gccgagcagatcggcatgagcaaggtcaccaatgtcggtcagacctcgctggagagcgtc
ggcaagttcaagaagatcgcggtcggcgaggaatttgtcatcgaatgcggcgattccaaa
ttcatcatgaaagccaacggcgaagtgatcatcctcggcaagacgttcaacttcgttgcg
accgaacacttccagatgcgcggcaagccgatcgacctgaactga

DBGET integrated database retrieval system