KEGG   Rickettsiales endosymbiont of Stachyamoeba lipophora: EF513_02220Help
Entry
EF513_02220       CDS       T05750                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ren  Rickettsiales endosymbiont of Stachyamoeba lipophora
Pathway
ren00564  Glycerophospholipid metabolism
ren01100  Metabolic pathways
ren01110  Biosynthesis of secondary metabolites
Module
ren_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ren00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EF513_02220
Enzymes [BR:ren01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     EF513_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AZL15372
UniProt: A0A3Q8T4K3
Position
complement(504118..504798)
Genome map
AA seq 226 aa AA seqDB search
MLDTIKKFIPPIHPEGYQFIIIFALVTVVLALFSNTLGLVGLVLTIWCVFFFRDPVRVIT
NGDSILVSPADGLVQKVSNVIPPEESGLPQVEMQRISIFLNVFNVHVNCIPCKGVVEMLH
YRPGKFLNAALDKASVDNERQVIRMKTEYGQKDILVVQIAGLIARRIVCNLENKQEVNKG
EKFGIIRFGSRTDVYLPMDIQVKIQEGQTVIGGETVIADILPTAKA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgttagatactattaaaaaatttataccgccaattcatccagagggatatcaatttatt
attatatttgccttagtgactgtggtccttgcattatttagtaatactttaggtttagta
ggtttggttttaactatttggtgtgtgtttttctttcgtgatcctgtaagagtgataact
aatggtgattctatattagttagtcctgcagatggattggtgcaaaaggtttctaatgtg
atacctcctgaagaatcaggattgccacaagttgaaatgcaaagaatcagcattttcctt
aacgtatttaatgtacatgttaattgtataccatgtaagggggtagttgaaatgctacat
tatcgtcctggtaagtttcttaatgctgcattagataaagcaagcgtcgataatgagaga
caagttattagaatgaaaaccgaatatgggcagaaagatatattagttgtgcagatagct
gggctcattgctagaaggatagtatgtaatcttgaaaataaacaggaagtcaataaaggt
gagaagtttggtattatccgctttggaagtagaacggatgtatatttacctatggatatt
caagttaaaatccaagaaggacaaactgtaattggcggtgaaacagtaattgcagatatt
cttccgacagctaaagcataa

DBGET integrated database retrieval system