KEGG   Rickettsiales endosymbiont of Stachyamoeba lipophora: EF513_04840Help
Entry
EF513_04840       CDS       T05750                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ren  Rickettsiales endosymbiont of Stachyamoeba lipophora
Pathway
ren03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ren00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EF513_04840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ren03011]
    EF513_04840
Ribosome [BR:ren03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EF513_04840
  Bacteria
    EF513_04840
  Archaea
    EF513_04840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AZL15869
UniProt: A0A3S8T3K7
Position
1048495..1048848
Genome map
AA seq 117 aa AA seqDB search
MTDTLRLSKAKLGVVRTSPIKLNNVAKLIRGLKADAALLQLKFCKKRISTEVRKCLLSAI
ANAENNHGMNIDDLYIDRIEVGKSILMKRFRARARGKGAKIEKFFSNITILLKERKA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacattaagattatctaaagcaaaattaggtgtggtaagaaccagtccgatt
aagcttaataatgttgctaagcttattcgtggattaaaagcagatgctgctttgttgcaa
cttaagttttgtaaaaaacgtatttcaaccgaagttagaaaatgtttactttcagcaatt
gcaaatgctgaaaataatcatggtatgaacatcgatgatttatatattgaccgcatagag
gtaggaaaatcaattcttatgaaaagatttcgtgctcgtgctagaggtaaaggtgcaaaa
atcgaaaaattctttagcaatataaccattttattaaaagaacgtaaggcatag

DBGET integrated database retrieval system