KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_CH00599Help
Entry
IE4803_CH00599    CDS       T03667                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00071  Fatty acid degradation
rep00072  Synthesis and degradation of ketone bodies
rep00280  Valine, leucine and isoleucine degradation
rep00310  Lysine degradation
rep00362  Benzoate degradation
rep00380  Tryptophan metabolism
rep00620  Pyruvate metabolism
rep00630  Glyoxylate and dicarboxylate metabolism
rep00640  Propanoate metabolism
rep00650  Butanoate metabolism
rep00900  Terpenoid backbone biosynthesis
rep01100  Metabolic pathways
rep01110  Biosynthesis of secondary metabolites
rep01120  Microbial metabolism in diverse environments
rep01130  Biosynthesis of antibiotics
rep01200  Carbon metabolism
rep01212  Fatty acid metabolism
rep02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IE4803_CH00599 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    IE4803_CH00599 (fadA)
   00640 Propanoate metabolism
    IE4803_CH00599 (fadA)
   00650 Butanoate metabolism
    IE4803_CH00599 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IE4803_CH00599 (fadA)
   00072 Synthesis and degradation of ketone bodies
    IE4803_CH00599 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IE4803_CH00599 (fadA)
   00310 Lysine degradation
    IE4803_CH00599 (fadA)
   00380 Tryptophan metabolism
    IE4803_CH00599 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IE4803_CH00599 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IE4803_CH00599 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IE4803_CH00599 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rep04147]
    IE4803_CH00599 (fadA)
Enzymes [BR:rep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IE4803_CH00599 (fadA)
Exosome [BR:rep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IE4803_CH00599 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJC77851
UniProt: A0A0A8G7Q6
Position
591813..593021
Genome map
AA seq 402 aa AA seqDB search
MTEVFIYDHVRTPRGRGKKDGALHEVPSVRLAAKTLEAIRDRNGLDTTTVDDIIMGCVDP
VMDAGAVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAGKIAQGADDIVIAGGVES
MSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFTRTDVDAYAVESQRRAGHA
WEQGWFDKSVVPVKDQNGLTILDKDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIQA
HPEIERINYVHHAGNSSGIVDGAGVVLLGSKAGGESMGLKPRARIKAFANIGSDPALMLT
GPVDVTEKLLKRTGMSLADIDLFELNEAFAAVVLRYMQAFDIDHDRINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggttttcatttacgatcacgtccgcacgccgcgcggccgcggcaaaaaggac
ggcgccctgcatgaagtgccgtccgtccgccttgcggccaagacgctggaagcgatccgc
gaccgcaacgggctcgacaccacgacggtcgacgacatcatcatgggttgcgtcgatccg
gtcatggatgccggcgccgtcatccccaaggccgccgccttcgaagcgggttattccacc
agggcgcccggcatgcagatctcccgtttctgcgcctccggcctcgatgccgtcaatttc
ggcgccggcaagattgcccaaggcgccgatgacatcgtcatcgcgggcggcgtcgaaagc
atgtcgcgtgtcggcctcggcatgtcgggcggcgcctggttcatggacccctcggtgaat
ttcccggcctatttcatgccgcagggcgtatcggccgatctcatcgccaccaaatacggt
ttcacccggaccgatgtcgacgcctacgccgtcgagagccagaggcgcgctggacatgcc
tgggagcagggttggttcgacaagtcggtcgtcccggtcaaggatcagaatggcctgacg
atcctcgataaggacgagcatatgcgccccggcaccgatatgcaggcgctcgcatccctc
aatccgtccttccagatgcccggcgagatgggcggcttcgaggccgtcggcatccaggcg
catcctgagatcgagcgcatcaactatgtccatcacgccggcaattcctccggcatcgtc
gatggcgcgggcgtcgtcctgctcggctcgaaggcgggtggcgagagcatgggactgaag
ccgcgcgcccgcatcaaggccttcgccaatatcggctccgatccggccctgatgctgacc
ggccctgtcgacgtcaccgagaaactgttgaagcggaccggcatgagccttgccgatatc
gacctcttcgagctgaacgaggccttcgccgccgtggtgctgcgctacatgcaggccttc
gacatcgaccacgacaggatcaacgtcaatggcggcgccatcgccatgggccacccgctc
ggcgccaccggcgccatgatcctcggcacggtgctcgacgagcttgaacgccgcgacttg
aacaccgcgctggtgacgctctgcatcggcgccggcatgggcacggcaaccgtaatcgaa
cgcgtttga

DBGET integrated database retrieval system