KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_CH01597Help
Entry
IE4803_CH01597    CDS       T03667                                 

Definition
(GenBank) glutathione peroxidase protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00480  Glutathione metabolism
rep00590  Arachidonic acid metabolism
rep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    IE4803_CH01597
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    IE4803_CH01597
Enzymes [BR:rep01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     IE4803_CH01597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AJC78828
UniProt: A0A0A8GA10
Position
1615356..1615904
Genome map
AA seq 182 aa AA seqDB search
MTANVLDIPVKSVDGRETTLNDYKGRVLLIVNVASKCGLTPQYEGLEKLYGEKRERGFVI
AAFPANDFKGQEPGTDAEILDFCTSTYDVTFPIFSKISVKGETQHPLYRQLTKSGVKTTG
DGPMRERLKAHGISAGDEDDILWNFEKFLIGRDGKVVARFAPDVTADDSRLVSAVDKELA
KG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgaacgtgctggatattcctgtcaaatcagtggatggtcgtgaaaccacgctc
aacgactataagggcagggtgctcttgatcgtcaatgtcgcctcgaaatgcgggctcacg
ccgcaatatgaggggctcgaaaagctctacggggaaaagcgcgagcgcggcttcgtcatc
gccgctttccccgccaacgatttcaagggccaggagcccggcaccgacgccgagatcctc
gatttctgcaccagtacctacgacgtcaccttcccgatcttctcgaagatctcggtcaag
ggcgagacccagcacccgctttaccggcagctgaccaaatcaggcgtgaagactaccggc
gacggcccgatgcgcgaacggctgaaagcccatggcatatcagccggcgatgaggacgac
attctctggaacttcgaaaaattcctgatcggccgcgacggcaaagtcgtcgcccgcttc
gcgcctgacgtgacggcggatgattcgcggctggtttcggcagtggataaggaactggcg
aaggggtga

DBGET integrated database retrieval system