KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_CH04318Help
Entry
IE4803_CH04318    CDS       T03667                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00790  Folate biosynthesis
rep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rep00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    IE4803_CH04318
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rep04147]
    IE4803_CH04318
Enzymes [BR:rep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     IE4803_CH04318
Exosome [BR:rep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IE4803_CH04318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AJC81454
UniProt: A0A0A8GLF0
Position
complement(4379767..4380072)
Genome map
AA seq 101 aa AA seqDB search
MKWERLERAAVEAELAGLAGWALNDAASSISKTFKFSNFIEAFGFMTEAAITAEKLNHHP
EWFNVYSRVDVTLNTHDAGGLTELDFKLAKAMEKAAARRPR
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgggaaagactggaacgggcagcggtcgaggcggagctggcgggccttgccggc
tgggcgctcaatgacgcggcctcctcgatctccaagacattcaagttttcgaatttcatc
gaggccttcggcttcatgacggaggcagcgatcacggccgagaagctcaaccatcatccc
gaatggttcaacgtctattccagggtcgatgtgacgttgaacacgcatgatgccggcggg
ctgacggagctggatttcaagctcgccaaggcgatggagaaggcggcagcgcgacgtccg
cgctga

DBGET integrated database retrieval system