KEGG   Rhodococcus hoagii: REQ_06410Help
Entry
REQ_06410         CDS       T01352                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
req  Rhodococcus hoagii
Pathway
req00051  Fructose and mannose metabolism
req01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    REQ_06410
Enzymes [BR:req01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     REQ_06410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: CBH46759
UniProt: E4WCV5
Position
663964..664791
Genome map
AA seq 275 aa AA seqDB search
MATTMKLGKAELMKTAEKAMLTEVSTAQWTDRQKIALTCRALFDAGHDSGLAGQISARGP
RPGTFLTQRLGLGFDEITEGNLLLVDEDLQVLEGSGMANPANRFHSWIYRARPDVNCIVH
THPLHAAALSMLEIPLQISQMDTAPLYDDCAFLPDWPGVPVGNEEGEIISAALGDKRAIL
LAHHGQLVVGATIEEACSSAHLIERAARLQLLAMAAGEIKPLPPRLAKEAHDWTLTPRRS
EANFGYYARRALRSHPDAIDHDLSNPTAEPDWTAR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacgatgaagctcggtaaggccgagttgatgaagaccgccgagaaggcgatg
ctcaccgaggtgtcgacggcgcagtggacggatcggcagaagatcgccctcacgtgccgt
gcgctgttcgacgccggtcacgactccgggctcgcgggtcagatctcggcgcgcggtccg
cggccgggaacctttctgacgcagcggctggggctcgggttcgacgagatcaccgagggc
aatctgctgctcgtcgacgaggacctgcaggttctcgaagggagtggaatggcgaacccg
gccaacaggttccacagctggatctaccgggcgcggccggacgtgaactgcatagtccac
acgcatccgctgcacgcggcggcgttgtcgatgctcgagatcccgctgcagatctcgcag
atggacaccgcgccgctctacgacgactgcgcgttcctgcccgactggccgggggtgccc
gtcggcaacgaggagggcgagatcatctccgccgcactgggagacaagcgggcgatcctg
ctcgcgcaccacggacagctggtggtgggggcgacgatcgaggaggcctgctcgtcggca
cacctgatcgaacgcgcggcccggctgcagttgctcgccatggcggcgggcgagatcaag
ccgctcccgccgcggctggcgaaggaagcgcacgactggacgctgaccccgcggcgcagt
gaggcgaacttcggctactacgcccgccgggcgctgcgctcgcacccggacgcgatcgac
cacgacctctcgaatccgaccgccgaacccgattggactgcacggtga

DBGET integrated database retrieval system