KEGG   Rhodococcus hoagii: REQ_06810Help
Entry
REQ_06810         CDS       T01352                                 

Definition
(GenBank) 2-hydroxymuconate-semialdehyde hydrolase
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
req  Rhodococcus hoagii
Pathway
req00984  Steroid degradation
req01100  Metabolic pathways
req01120  Microbial metabolism in diverse environments
req01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:req00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    REQ_06810
Enzymes [BR:req01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     REQ_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 DUF1057 Esterase Ndr Thioesterase
Motif
Other DBs
NCBI-ProteinID: CBH46798
UniProt: A0A3S5Y2P7
Position
707270..708175
Genome map
AA seq 301 aa AA seqDB search
MTATEELTYESTSRFAQVRDDLKLHYHEAGVGNGPTIVLLHGGGPGASSWSNFAKNIPVL
AQQFHVIAVDQPGYGRSDKPTEHPQYFRHSASALKDLLDTIGITERVHLLGNSLGGGAAV
RFALDYPDRAGRLVLMGPGGLSVNLFAPDPTEGVRNLGKFAYQPTRENLEAFLRIMVFDQ
KLITDELIDERFAAASAPESLAAAKAMGRSFSSSEFELGMLWRDAYKLRQRVLLIWGRED
RVNPIDGALVALKMIPRVQLHVFGGCGHWAQLEKFDEFNRLASDFLLDSDIARGSGREGG
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaaccgaggagctcacgtacgagtcgacctcgcgcttcgcgcaggtccgcgac
gacctgaagttgcactaccacgaggcgggtgtcggcaacggccccacgatcgtgctgctg
cacggcggcggtcccggcgcgtcgtcgtggtccaacttcgcgaagaacattcccgttctc
gcgcagcagttccacgtgatcgcggtggaccagcccggctacggccggtccgacaagccc
accgagcacccccagtacttccggcacagtgcgtcggcgctgaaggatctgctcgacacg
atcggtatcaccgagcgcgttcacctgctgggcaattcgctcggcggcggtgccgcggtg
cggttcgcgctggactaccccgatcgcgccggccggctggtgctcatgggccccggtggc
ctgagcgtcaacctcttcgcaccggatcccaccgagggcgtccggaatctcggcaagttc
gcgtaccagcccacgcgggagaacctcgaggcgttcctgcgcatcatggtgttcgaccag
aagctcatcaccgacgagctgatcgacgagcggttcgccgccgccagtgcgcccgagtcg
ctggcggccgccaaggcgatgggtaggtcgttctcgagttcggagttcgagctcggaatg
ttgtggcgcgacgcctacaagctgcgtcagcgggtgttgttgatctggggtcgcgaggac
cgggtcaaccccatcgacggtgcgctggtggcgctcaagatgattccgcgggtccagctg
cacgtcttcggcggctgtggacactgggcgcagctcgagaagttcgacgagttcaaccgg
ctcgcgagcgacttcctgctcgacagtgacatcgcccgaggctccggccgagaagggggt
aagtga

DBGET integrated database retrieval system