KEGG   Rhodococcus hoagii: REQ_17700Help
Entry
REQ_17700         CDS       T01352                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
req  Rhodococcus hoagii
Pathway
req00071  Fatty acid degradation
req00072  Synthesis and degradation of ketone bodies
req00280  Valine, leucine and isoleucine degradation
req00310  Lysine degradation
req00362  Benzoate degradation
req00380  Tryptophan metabolism
req00620  Pyruvate metabolism
req00630  Glyoxylate and dicarboxylate metabolism
req00640  Propanoate metabolism
req00650  Butanoate metabolism
req00900  Terpenoid backbone biosynthesis
req01100  Metabolic pathways
req01110  Biosynthesis of secondary metabolites
req01120  Microbial metabolism in diverse environments
req01130  Biosynthesis of antibiotics
req01200  Carbon metabolism
req01212  Fatty acid metabolism
req02020  Two-component system
Brite
KEGG Orthology (KO) [BR:req00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    REQ_17700
   00630 Glyoxylate and dicarboxylate metabolism
    REQ_17700
   00640 Propanoate metabolism
    REQ_17700
   00650 Butanoate metabolism
    REQ_17700
  09103 Lipid metabolism
   00071 Fatty acid degradation
    REQ_17700
   00072 Synthesis and degradation of ketone bodies
    REQ_17700
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    REQ_17700
   00310 Lysine degradation
    REQ_17700
   00380 Tryptophan metabolism
    REQ_17700
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    REQ_17700
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    REQ_17700
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    REQ_17700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:req04147]
    REQ_17700
Enzymes [BR:req01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     REQ_17700
Exosome [BR:req04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   REQ_17700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Ketoacyl-synt_C SpoVAD
Motif
Other DBs
NCBI-ProteinID: CBH47839
Position
1875628..1876821
Genome map
AA seq 397 aa AA seqDB search
MTTSVIVAGARTPVGRLLGSLKDLSGSDLGGVAIKGALEKAGVAPEQVDYVIMGQVLTAG
AGQMPARQAAVAAGIPMDVPALTINKVCLSGIDAIALADQLIRAGEFEIVVAGGQESMSR
APHMLEKSREGFKYGDVTLRDHMAYDGLHDIFTDQPMGNLTEQRNQDDDQRITREAQDAF
AAASHQNAARAWKDGLFAEEVVPVTIPQRRGEPIVVTEDEGIRADTTVESLAKLRPAFAK
DGSITAGTASQISDGAAAVVVMSKEKAEALGLEWIAEIGAHGVVAGPDSTLQSQPARAIA
RACERDGIDPKDLDVVEINEAFAAVGIASTAELGIDPAKVNVNGGAIAIGHPLGMSGARI
ALHLVLELQRRGGGVGAAALCGGGGQGDALIVRVPKK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgaccacttctgtcatcgttgccggggcacgtacccccgtcggacggctgctcggatcc
ctgaaggatctctcggggtccgacctcggcggtgtagcgatcaagggcgcactcgagaag
gccggcgtggcgcccgagcaggtcgactacgtgatcatgggccaggttctcaccgcgggc
gccgggcagatgccggcgcgtcaggccgccgtcgccgcgggcatcccgatggacgtcccc
gccctcacgatcaacaaggtgtgcctgtcgggcatcgacgcgatcgccttagcggaccag
ttgatccgtgccggagagttcgagatcgtggtggccggtggccaggagtccatgtcgcgg
gccccgcacatgctcgagaagagccgcgagggcttcaagtacggcgacgtcacgctgcgc
gaccacatggcctacgacggcctgcacgacatcttcaccgaccagccgatgggcaacctc
accgagcagcgcaaccaggacgacgatcagcgcatcacgcgggaggcgcaggacgcgttc
gcggccgcctcgcaccagaacgccgctcgcgcctggaaggacggcctgttcgccgaggag
gtcgtgccggtcaccatcccgcagcgccgcggtgagccgatcgtcgtcaccgaggacgag
ggcatccgcgccgacaccaccgtcgagtcgctcgccaagttgcgcccggcgttcgcgaag
gacggttcgatcacggccggcaccgcatcgcagatctccgacggcgcggccgcggtcgtc
gtgatgagcaaggagaaggccgaggcgctcgggctcgagtggatcgcggagatcggtgcc
cacggcgtcgtcgcaggaccggactcgacgctgcagtcgcagccggcgcgagcgatcgcc
cgcgcctgcgagcgcgacggcatcgaccccaaggacctcgacgtcgtcgagatcaacgag
gccttcgcggctgtgggcatcgcgtcgacggccgagctgggcatcgacccggcgaaggtc
aacgtcaacggcggcgcaatcgcgatcggccatccgctcggcatgtccggagcccggatc
gcgctgcacctcgtgctggagctgcagcgccgcggcggcggcgtcggtgcggccgcgctg
tgcggtggcggcgggcagggcgacgccctgatcgtgcgggtgcccaagaagtag

DBGET integrated database retrieval system