KEGG   Rhodococcus hoagii: REQ_26530Help
Entry
REQ_26530         CDS       T01352                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
req  Rhodococcus hoagii
Pathway
req00330  Arginine and proline metabolism
req00360  Phenylalanine metabolism
req00380  Tryptophan metabolism
req00627  Aminobenzoate degradation
req00643  Styrene degradation
req01100  Metabolic pathways
req01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:req00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    REQ_26530
   00360 Phenylalanine metabolism
    REQ_26530
   00380 Tryptophan metabolism
    REQ_26530
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    REQ_26530
   00643 Styrene degradation
    REQ_26530
Enzymes [BR:req01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     REQ_26530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: CBH48678
UniProt: A0A3S5Y857
Position
2805382..2806419
Genome map
AA seq 345 aa AA seqDB search
MRHGDISSSNDTVGVAVVNYKMPRLHDKAGVLDNARRIADMMIGMKSGLPGLDLVVFPEY
STQGIMYDEREMYETAATIPGDETAIFSAACREADTWGVFSITGEQHEEHPNKPPYNTLI
LVNNRGEIVQKYRKILPWCPIEGWYPGDTTHVTEGPKGLKISLIVCDDGNYPEIWRDCAM
KGAELIVRCQGYMYPAKDQQVLMSKAMAWANNCYVAVANAAGFDGVYSYFGHSAIIGFDG
RTLGETGEEEYGIQYAQLSVSAIRDARENDQSQNHLFKLLHRGYSGIHAAGDGDKGVADC
PFEFYKLWVTDAEKARERVESITRDTVGVADCRVGSLPVEQTSEA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgacacggagatatctcctcgagcaacgacaccgtcggagtggcggtggtgaattac
aagatgcctcgactgcacgacaaggccggagtcctcgacaacgcacgacgaatcgccgac
atgatgatcggcatgaagtcgggactgccggggctcgacctggtggtgttccctgagtac
tccacgcagggaatcatgtacgacgaacgagagatgtacgagacggcggcaacgattccc
ggcgacgagaccgcgatcttctcggccgcgtgccgcgaagccgacacctggggcgtcttc
tcgatcaccggcgagcagcacgaagaacacccgaacaagccgccctacaacaccctgatc
ctcgtgaacaacaggggcgagatcgtgcagaagtaccgaaagatcctgccgtggtgcccg
atcgaaggctggtatccgggcgacaccacacacgtgaccgaggggccgaagggcttgaag
atctcgctcatcgtatgcgacgacggcaactaccccgagatctggcgggactgcgcaatg
aagggcgccgaactgatcgtgcgctgccaagggtacatgtatccggcgaaggaccaacag
gtcctcatgtcgaaggccatggcgtgggcgaacaactgctacgtcgccgtagcgaacgcc
gccggattcgacggagtgtattcgtatttcggccactcggcgatcatcgggttcgacggc
cgcaccctcggcgagacaggcgaggaggagtacggcatccagtacgcacagttgtcggtc
tccgccattcgagacgcccgcgagaacgaccagtcccagaaccacctgttcaagttgttg
catcgcggctactccggcattcacgctgcaggtgacggcgacaagggcgtggcggattgc
cccttcgagttctacaagctgtgggtcaccgatgccgagaaggcccgagagcgcgtcgag
tcgatcacgagagacactgtcggcgtggcggattgcagggtgggatcgctgcccgtcgaa
cagacctccgaggcctga

DBGET integrated database retrieval system