KEGG   Rhodococcus hoagii: REQ_28750Help
Entry
REQ_28750         CDS       T01352                                 

Definition
(GenBank) RNase H domain phosphoglycerate/bisphosphoglycerate mutase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
req  Rhodococcus hoagii
Pathway
req00860  Porphyrin and chlorophyll metabolism
req01100  Metabolic pathways
req03030  DNA replication
Module
req_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:req00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    REQ_28750
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    REQ_28750
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:req03032]
    REQ_28750
Enzymes [BR:req01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     REQ_28750
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     REQ_28750
DNA replication proteins [BR:req03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     REQ_28750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: CBH48893
UniProt: A0A3S5Y8S0
Position
complement(3056576..3057709)
Genome map
AA seq 377 aa AA seqDB search
MTSDRVVVEADGGSRGNPGPAGYGAVVFDADRGRVLAERREFLGVATNNVAEYRGLIAGL
AAARDLGAHEVDVRMDSKLVVEQMSGRWKVKHPDMIPLAQRARELADGFARVDFTWIPRA
ENSHADRLANEAMDGEDAITSGFADTDPATGSETSPATDTESAAATSPGWTGAVGAPTRM
LLLRHGQTALSVERRYSGHGNPPLTAFGRTQARSAAQRIADKGAIAAVVSSPLGRARETA
AAAAEALGLPVTVHDGLIETDFGKWEGLTFAEAQQRDPDVHTRWLSDTSVRPPEGESFDE
VRSRIETVRDDLTASYPGANILVVTHVTPIKTLLQLALDVGPSLLYRLHLDLASLSIAEF
YPDGGSSVRLVNDTSHL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcggatcgtgtcgtcgtcgaggccgacggcggatcccgcggtaatcccggcccg
gcaggctacggcgcggtggtgttcgacgccgaccgtggccgggtgctcgccgagcgtcgg
gagttcctcggggtggccacgaacaacgtcgccgagtaccgcggactgatcgccggactg
gccgcggcccgggacctcggtgcccacgaggtggacgtccggatggactccaagctcgtc
gtcgagcagatgtcgggacgctggaaggtcaagcacccggacatgatcccgctcgcacag
cgcgcgcgggagctggccgacgggttcgcccgggtggacttcacgtggatcccgcgagcc
gagaactcgcacgccgatcgcctcgccaacgaggcgatggacggggaggacgccatcacg
tccgggttcgcggataccgacccggcgaccggctccgagacttcccccgcgaccgacacc
gagtccgccgccgcgacgtcccccggctggaccggcgcggtcggtgcgccgacccgcatg
ctgctgctgcgccacggccagaccgcactgtccgtcgaacgccggtactcgggccacggc
aacccgccgctcaccgcgttcgggcgtacccaggcgcggtcggcggcgcagcggatcgcc
gacaagggcgcgatcgccgcggtcgtgagctcaccactcggccgggcccgcgagaccgcc
gccgcggcggctgaggcgctgggactgccggtcaccgtccacgacggcctgatcgagacc
gatttcggcaagtgggaggggctgacgttcgccgaggcccagcagcgcgaccccgacgtt
cacacccgctggctgtcggacacctcggtgcgcccgccggaaggcgagagcttcgacgag
gtgcggtcccggatcgagacggtccgggacgacctgacggcgtcctatcccggcgccaac
atcctggtcgtgacgcatgtgacgccgatcaagacactgctccaactggcgctcgacgtc
ggaccgtcgctgctgtatcgcctgcatctggatctggcgtcgctgagcatcgccgagttc
tacccggacggcggttcgtcggtccggctggtcaacgatacgtcgcacttgtag

DBGET integrated database retrieval system