KEGG   Rhodococcus hoagii: REQ_33540Help
Entry
REQ_33540         CDS       T01352                                 

Gene name
scoB
Definition
(GenBank) 3-oxoacid CoA-transferase ScoB
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
req  Rhodococcus hoagii
Pathway
req00072  Synthesis and degradation of ketone bodies
req00280  Valine, leucine and isoleucine degradation
req00650  Butanoate metabolism
req01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:req00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    REQ_33540 (scoB)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    REQ_33540 (scoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    REQ_33540 (scoB)
Enzymes [BR:req01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     REQ_33540 (scoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: CBH49350
UniProt: A0A3S5YA30
Position
complement(3564370..3565017)
Genome map
AA seq 215 aa AA seqDB search
MTQAIAQKLTREQMAARVARELADGQYVNLGIGMPTLVPNYIPEDITVVLHSENGVLGVG
PYPTEDELDPELINAGKETITVLPGASYFDSSQSFGMIRGGQVDVAVLGAMQVSARGDLA
NWMIPGHMVKGMGGAMDLVHGAKRVIVMMEHVSKKGESKILDECTLPLTGKGCVQRIITD
MAVLDVTDEGLRLVETAPGIGVDDVVAATAAKLLV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcaattgcgcagaagctgacccgcgagcagatggccgcccgggtcgcccgg
gaactcgccgacggtcagtacgtcaacctcggcatcggcatgccgactctggtgccgaac
tacattcccgaggacatcaccgtcgtgctgcactccgagaacggagtgctcggcgtgggc
ccgtaccccaccgaggacgaactcgaccccgaactgatcaacgcgggcaaggagaccatc
acggtcctgccgggcgcgtcgtacttcgactcgtcgcagtcgttcgggatgatccgcggc
ggtcaggtggacgtcgccgtcctcggcgcgatgcaggtcagcgcccgcggtgatctcgcc
aactggatgatccccggccacatggtcaagggcatgggcggtgcgatggacctcgtccac
ggcgccaagcgggtgatcgtgatgatggaacacgtctccaagaagggcgaatccaagatc
ctcgacgagtgcaccctgccgctcaccggcaagggttgcgtccagcggatcatcaccgac
atggccgtcctcgacgtcaccgacgagggcttgcggctggtcgagacggcccccggcatc
ggcgtcgacgatgtggtcgcggccaccgcggcgaagctgctggtgtag

DBGET integrated database retrieval system