KEGG   Rhodococcus hoagii: REQ_37160Help
Entry
REQ_37160         CDS       T01352                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
req  Rhodococcus hoagii
Brite
KEGG Orthology (KO) [BR:req00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    REQ_37160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CBH49703
UniProt: A0A3S5YAU3
Position
3967854..3969062
Genome map
AA seq 402 aa AA seqDB search
MTAELVVLLVVVVTALAFDFTNGFHDTGNAMATSIATGALRPKVAVALSATLNLVGAFLS
VEVAATVAKGVVNLGSVSGEALLLIVFAGLVGGILWNLATWLFGMPSSSSHALFGGLIGA
AIASIGMSGVEWGGVMGKVILPALLAPVVAALVAAVGTKLIYRITRDVPDDTKGKGFRIG
QVGTASLVSLAHGTNDAQKTMGVIFLALVAHGSISADAEMPFWVKLSCAVAIALGTYLGG
WRIIRTLGKGLVEIAAPQGMAAESSSAAIILTSSHLGLPLSTTHVATGSILGTGLGRRGA
EVRWGVAGRMAVAWLITLPSAGIVGAVCWALAHVIGGLPGVLVVFALLVALSVFMYLRSR
RQPIDPTNVNAEWEDGLEPATDKAATAPARQADADTTTRSHH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcagagctcgtcgttctcttggtagtggtcgtcactgccctcgctttcgatttc
acgaacggcttccacgacaccggaaacgcgatggccacctccatcgccaccggcgcactt
cgaccgaaggtcgcagtggcactctctgcaaccctgaacctggtcggcgcctttctctcc
gtcgaggtcgcggccaccgtcgcgaaaggcgtggtcaacctcggatccgtcagcggcgag
gcactacttctgatcgtgttcgccggcctcgtgggcggtatcctgtggaacctcgcgacg
tggttgttcggcatgccgtccagctcgtcgcacgccctcttcggcggcctcatcggtgcc
gcgatcgcctcgatcggcatgagcggcgtcgagtggggcggcgtgatgggcaaggtcatc
ctgcccgcgctgctcgcgcccgtcgtcgcggcgctcgtcgccgctgtcggcaccaagctg
atctaccgcatcacccgtgacgtccccgacgacacgaagggcaagggcttccgcatcggc
caggtcggtacggcgtccctcgtctcgctggcgcacggcaccaacgacgcccagaagacg
atgggcgtgatcttcctggcgctcgtcgcgcacgggtccatctccgcggatgccgagatg
ccgttctgggtgaagctgagctgcgccgtcgcgatcgccctgggcacctatctcggcgga
tggcgcatcatccgcacgctgggcaagggtctggtcgagatcgccgcgcctcagggcatg
gccgccgagtcgtcgtcggccgcgatcatcctcacctccagccatctcggcctgccgctg
tcgaccacccacgtcgcgaccgggtcgatcctcggtaccggactcggacgccggggcgcc
gaggtccgctggggcgtggccggacggatggccgtagcgtggctgatcaccctgccgtcc
gccggcatcgtcggtgccgtctgctgggcgttggcccacgtcatcggcggtctcccgggc
gtgctcgtcgtcttcgccctgctcgtggccctgtcggtcttcatgtacctgcgctcgcgc
cgtcagccgatcgatcccaccaacgtcaacgccgagtgggaggacggactcgagcccgcg
acggacaaggctgccacggcacccgctcgccaggccgacgccgacaccaccacccgcagc
caccactga

DBGET integrated database retrieval system