KEGG   Rhodococcus hoagii: REQ_41100Help
Entry
REQ_41100         CDS       T01352                                 

Definition
(GenBank) putative secreted glycosyl hydrolase family 3
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
req  Rhodococcus hoagii
Pathway
req00520  Amino sugar and nucleotide sugar metabolism
req01100  Metabolic pathways
req01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    REQ_41100
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    REQ_41100
Enzymes [BR:req01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     REQ_41100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 DUF1707
Motif
Other DBs
NCBI-ProteinID: CBH50079
UniProt: E4W9F4
Position
complement(4366510..4367715)
Genome map
AA seq 401 aa AA seqDB search
MSTTVGTMRIRHAFALALCAGLAAGCSSGNGTDTTATSQPSTSESAASSTSTTSQAPPAP
GPFGSAVCGPGFLKSLTERQKLAQLLTVGVTGAADALDVVKSEGIGGIFIGSWTDESMLA
NGEAAQVAEASAVPLMVTIDEEGGRVSRVDQLFGPDPSAREVARTMTTDQAYEMALERGR
KLRSVGITVNFAPDVDVSSQPDDSVIGDRSFSDDPEVVTRYADAYARGMRDAGILPVIKH
FPGHGSASGDSHTGAVTTPPLDQLQKTDLVPFRNLVDTEVGVMLGHLSVPGLTTDGLPAS
LSPQAVDLLRKGTGYDAPPFEGVIFTDDLSGMKAITDRFDIADAVEQALKSGVTSALWLT
TDDVPRVLDHLEDAVAKGRLPQSQVDESVLTVAREKGAVSC
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactacggtcggaaccatgcgaatccgacatgcgttcgccctcgccctgtgcgcc
ggtctcgcggccgggtgctcgtccgggaacgggaccgacaccaccgcgacgtcccagccg
tcgacgtccgaatcagcggcgtcgtcgacgtcgaccacctcgcaggcgccgccggcgccg
ggaccgttcggctccgcggtgtgcggacccggtttcctgaagtcgctcacggagcggcag
aagctggcgcagctgctaacggtgggcgtcacgggtgccgcggacgccctcgacgtcgtg
aagtccgagggcatcggtggcatcttcatcggcagctggaccgacgagtcgatgctcgcg
aacggggaggccgcgcaggtcgcggaagccagcgcggtgccgctcatggtgaccatcgac
gaggagggcggccgggtgtcccgcgtcgaccagctgttcgggccggacccgtcggcgcgg
gaggtcgcgcgcaccatgacgacggaccaggcctacgagatggcactcgagcgcggccgc
aagctgcgcagtgtcgggatcaccgtcaacttcgcccccgacgtcgacgtgagcagccag
ccggacgactcggtgatcggcgaccgatcgttctcggacgatccggaggtggtcacccgg
tacgccgacgcgtacgcccgtggcatgcgcgacgccgggatcctgccggtcatcaagcac
tttccgggccacggatcggcgtccggtgattcgcacaccggcgccgtcaccacgccgccg
ctcgaccagttgcagaagactgacctcgtgccgttccggaacctggtcgacaccgaggtc
ggcgtgatgttgggtcatctcagcgttcccggtctcaccaccgacgggctgccggcgagc
ctgagcccgcaggccgtcgacctgctccggaaggggacgggctacgacgcgcccccgttc
gaaggggtgatcttcaccgacgacctgagcgggatgaaggcgatcaccgatcggttcgac
atcgccgacgcggtggagcaggccctgaagtccggcgtgacgtcggcgctgtggctcacg
accgacgacgtgccgcgggtgctggaccatctcgaggacgcggtcgcgaagggacggttg
ccccagtcgcaggtggacgagtcggtgctgacggtggcgcgcgagaagggcgctgtgagc
tgctga

DBGET integrated database retrieval system