KEGG   Rhodococcus hoagii: REQ_43910Help
Entry
REQ_43910         CDS       T01352                                 

Gene name
choE
Definition
(GenBank) secreted cholesterol oxidase ChoE
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
req  Rhodococcus hoagii
Pathway
req00984  Steroid degradation
req01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    REQ_43910 (choE)
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     REQ_43910 (choE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N Pyr_redox_2 FAD_binding_2 NAD_binding_8 FAD_binding_3 TAT_signal DAO
Motif
Other DBs
NCBI-ProteinID: CBH50354
UniProt: E4WA79
Position
4687101..4688756
Genome map
AA seq 551 aa AA seqDB search
MTDSRANRADATRGVASVSRRRFLAGAGLTAGAIALSSMSTSASAAPSRTLADGDRVPAL
VIGSGYGGAVAALRLTQAGIPTQIVEMGRSWDTPGSDGKIFCGMLNPDKRSMWLADKTDQ
PVSNFMGFGINKSIDRYVGVLDSERFSGIKVYQGRGVGGGSLVNGGMAVTPKRNYFEEIL
PSVDSNEMYNKYFPRANTGLGVNNIDQAWFESTEWYKFARTGRKTAQRSGFTTAFVPNVY
DFEYMKKEAAGQVTKSGLGGEVIYGNNAGKKSLDKTYLAQAAATGKLTITTLHRVTKVAP
ATGSGYSVTMEQIDEQGNVVATKVVTADRVFFAAGSVGTSKLLVSMKAQGHLPNLSSQVG
EGWGNNGNIMVGRANHMWDATGSKQATIPTMGIDNWADPTAPIFAEIAPLPAGLETYVSL
YLAITKNPERARFQFNSGTGKVDLTWAQSQNQKGIDMAKKVFDKINQKEGTIYRTDLFGV
YKTWGDDFTYHPLGGVLLNKATDNFGRLPEYPGLYVVDGSLVPGNVGVNPFVTITALAER
NMDKIISSDIQ
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatagccgggcgaacagagccgatgcgactcggggggttgcatccgtctcacgc
cgtcgattccttgcgggcgcaggtctgaccgcgggagccatcgcgctctcgtcgatgtcg
acctccgcctccgcagcccccagccgcaccctcgccgacggcgaccgcgtccctgccctc
gtcatcggcagtggatacggcggtgccgtcgccgcgctgcggctgacgcaggccggtatc
cccacgcagatcgtcgagatgggccgcagctgggacacccccggctccgacggcaagatc
ttctgcgggatgctcaaccccgacaagcgctcgatgtggttggccgacaagaccgatcag
ccggtcagcaacttcatgggcttcggcatcaacaagagcatcgaccggtacgtcggcgtc
ctcgactccgagcggttctccggcatcaaggtctaccagggccgcggcgtcggcggcggc
tcgctcgtcaacggcggtatggcagtcaccccgaagcgcaactacttcgaggagatcctg
ccgtcggtcgactcgaacgagatgtacaacaagtacttcccgcgcgccaacaccggtctg
ggtgtcaacaacatcgaccaggcgtggttcgagtccaccgagtggtacaagttcgcccgc
accggccgcaagaccgcccaacgttcgggtttcacaaccgctttcgtgcccaacgtgtac
gacttcgagtacatgaagaaggaggctgccggccaggtcaccaagtcgggcctcggcggt
gaggtcatctacggcaacaacgccggcaagaagtcgctcgacaagacctacctcgcgcag
gccgcggccaccgggaagctgacgatcacgactctgcaccgcgtcaccaaggtcgcgccg
gccaccggcagcggctacagcgtgacgatggaacagatcgacgagcagggcaacgtcgtc
gccaccaaggtcgtcaccgccgatcgggtgttcttcgcggccggcagcgtcggcaccagc
aagctcctggtctcgatgaaggcgcagggccacctgccgaacctgtcgtcgcaggtcggc
gagggctggggcaacaacggcaacatcatggtgggccgcgcgaaccacatgtgggacgcc
accggatccaagcaggccaccatcccgacgatgggaatcgacaactgggccgacccgacg
gcaccgatcttcgcggagatcgccccgctgccggccgggctcgagacctacgtcagcctg
tacctggccatcacgaagaaccccgaacgtgctcgcttccagttcaattcgggcaccggc
aaggtcgatctcacctgggctcagtcgcagaaccagaagggcatcgacatggccaagaag
gtgttcgacaagatcaaccagaaggaaggcacgatctaccggaccgatctgttcggcgtg
tacaagacgtggggcgacgacttcacataccacccgctgggcggcgtgctgctgaacaag
gcgaccgacaacttcggccgcctgcccgagtaccccggcctgtacgtcgtggacggctcg
ctcgtccccggcaatgtcggcgtcaacccgttcgtcacgatcaccgcgctcgccgagcgc
aacatggacaagatcatctcgtccgacatccagtga

DBGET integrated database retrieval system