KEGG   Rhodococcus hoagii: REQ_44040Help
Entry
REQ_44040         CDS       T01352                                 

Definition
(GenBank) putative zinc binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
req  Rhodococcus hoagii
Pathway
req00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:req00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    REQ_44040
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     REQ_44040
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     REQ_44040
    1.1.1.-  
     REQ_44040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc FAD_binding_3 DAO Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: CBH50367
UniProt: A0A3S5YCS2
Position
complement(4699670..4700713)
Genome map
AA seq 347 aa AA seqDB search
MRAAVLHGIDDLRVEDVPEPELPDGYVLVDVAFNGICGSDLGMIHSFGISEHPHPLTGAC
GPQILGHEFSGIVCAVGAGVVDVAVGDRVAVQPNYHCGTCARCRDGHEHLCTSAAFHGIN
APGGGLAERTAVPAENVHVLPDGVSLEQAAVVEPLAVALHAVELSGVGHTDFALILGAGP
IGIATALNLCADGVDRILLSEPSETRRAVATALGLDVIDPTATDLVAAVQERTDGAGADV
VFECAGVGAALQTALAAVRPRGAVVLLATYKEQVPLNTYALMFGEMRLMSSLAYSRKEFT
SVINRMAAGAYPLDGWVERVPLADVLDGVQAASDGRRMKVLVEVAHV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgagggccgctgtcctgcacggcatcgacgacctgcgggtcgaggacgtgccggaaccg
gagctgccggacgggtacgtcctcgtcgacgtggcgttcaacggcatctgcggatccgat
ctcggcatgatccactcgttcgggatctccgagcatccgcatccgctcaccggcgcgtgc
ggcccacagatcctcggccacgagttctccggcatcgtttgcgcggtgggcgccggtgtc
gtcgacgtcgccgtcggcgaccgggtcgcggtgcagcccaactatcactgcggcacgtgt
gcccggtgccgggacgggcacgagcacctgtgcacgtcggcggccttccacgggataaac
gctccgggaggcgggttggccgagcgcaccgccgtgcccgcggagaacgtgcacgtgctg
cccgacggcgtctcgctcgaacaggccgcggtggtggaaccgctggcggtcgcgttgcac
gccgtcgaactgtccggcgtcgggcacaccgacttcgccctgatcctcggggccgggccc
atcggcatcgcgaccgcactcaacctgtgtgcggacggtgtggaccggatcctgctcagt
gagccgtccgagacaaggcgtgcggtcgcgaccgcgctgggcctcgacgtgatcgatccg
acggcgaccgatctcgttgcggcggtgcaggaacgcaccgacggagcgggcgcggacgtc
gtgttcgagtgcgccggagtcggtgccgcgttgcagacggcgctcgctgccgttcggccc
cggggcgcggtggtgctgctcgcgacctacaaggagcaggtgcctctgaacacgtatgcg
ctgatgttcggcgagatgcggctgatgtcgtccctcgcatactcgcgcaaggaattcact
tccgtcatcaaccgtatggcggcgggcgcctatccgctcgacgggtgggtggagcgtgtc
ccgctcgcggacgtgctcgacggtgtccaggcggcgtccgacgggcgtcgcatgaaggtt
ctcgtggaggtagctcatgtctga

DBGET integrated database retrieval system