KEGG   Rhodococcus hoagii: REQ_44160Help
Entry
REQ_44160         CDS       T01352                                 

Definition
(GenBank) putative zinc binding alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
req  Rhodococcus hoagii
Pathway
req00010  Glycolysis / Gluconeogenesis
req00071  Fatty acid degradation
req00350  Tyrosine metabolism
req00625  Chloroalkane and chloroalkene degradation
req00626  Naphthalene degradation
req01100  Metabolic pathways
req01110  Biosynthesis of secondary metabolites
req01120  Microbial metabolism in diverse environments
req01130  Biosynthesis of antibiotics
req01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    REQ_44160
  Lipid metabolism
   00071 Fatty acid degradation
    REQ_44160
  Amino acid metabolism
   00350 Tyrosine metabolism
    REQ_44160
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    REQ_44160
   00626 Naphthalene degradation
    REQ_44160
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     REQ_44160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C TrkA_N ADH_N_2
Motif
Other DBs
NCBI-ProteinID: CBH50379
UniProt: E4WAA4
Position
complement(4710021..4711058)
Genome map
AA seq 345 aa AA seqDB search
MRALQLVEHGRIAVVDTDVPEIGPGEVLIEVAGAGLCHSDIHVRHSPVSMMPPPMTLGHE
TAGRVAALGDGVDAFAVGDAVLVFLVWSCGTCRACVQGRENSCERGTGRQGLPLCPGLAA
HGGMAEYMKVDARFVEPLGDLDPVTAGPLADAGLTTYHAIDGARDRLGPGTTAVVLGIGG
LGHTAVQILAATTATRIIAVDSAEEKLELATALGADHVFASDASCVGRILELTDGIGVDA
VFDCVGVQATVDIATQIIGRDGALRVLGLGGGTFAWTGFALPWGADVRTSYAGTRADQRA
VIDLARRGLVTIESETIPLEDAVAAFDALEAGKIKGRAILVPDHS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgttgcagctggttgagcacggacggatcgccgtcgtcgacaccgacgttcct
gagatcggccccggtgaggtcctgatcgaggttgccggtgcgggcttgtgccactccgac
atccacgttcggcactccccggtatccatgatgccgccgccgatgacgctgggacacgag
accgccggacgcgttgccgcactgggtgacggggtcgacgcattcgcggtaggcgacgcg
gtcctggtgttcctggtgtggagttgcggcacgtgccgcgcatgcgtgcagggacgcgag
aactcctgcgagcgcgggaccggacgccaggggctgccgctctgcccgggcctggccgcg
cacggcggcatggccgagtacatgaaggtcgacgcccgcttcgtcgaaccactcggggac
ctcgaccccgtcacggcagggccgttggccgacgccggcctgaccacctaccacgccatc
gacggcgcccgggaccgactggggcccggtacgacggccgtggtgctcggcatcggcggg
ctcggccacaccgcggtgcagatcctcgcggccaccaccgccacccggatcatcgcggtg
gactcggcggaggagaagctggaactggcaaccgcattgggcgccgatcacgtgttcgcc
agcgatgcgtcgtgcgtcggaaggattctcgaactgaccgacggcatcggcgtcgacgcg
gtcttcgactgtgtcggtgtgcaggccacggtcgacatcgccacgcagatcatcggacgc
gacggggccctgagagtgctgggcctgggcggcggaaccttcgcctggaccggcttcgcg
ctgccgtggggcgccgacgtgcgcacgagctacgccggcacccgtgcggaccagcgcgcg
gtgatcgacctggcgcgtcgcgggctcgtgacgatcgagtccgagacgattccgctcgag
gacgccgtcgctgccttcgacgcgctcgaggccggaaagatcaagggccgcgcgattctg
gtgcccgatcactcctga

DBGET integrated database retrieval system