KEGG   Rhodococcus erythropolis PR4: RER_04360
Entry
RER_04360         CDS       T00881                                 

Definition
(GenBank) putative carveol dehydrogenase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00903  Limonene and pinene degradation
rer01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rer00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RER_04360
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     RER_04360
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: BAH31144
NITE: RER_04360
UniProt: C0ZN92
Position
complement(486177..487028)
AA seq 283 aa
MTTTARTTGRVSGKVAFVTGAARGQGRAHAIRLAEEGADIIALDICSDIGGVPYSLASEA
DLAETVRSVEAVGGRILAEVADVRDFTAVKGVLDRGVVQFGHVDIVCANVGINIPSPTHE
LTESQWGTVVDIDLSGTWRTAKAAIPYLIEQGGGGAIILTSSAAGLKGYGNIAHYTAAKH
GVNGLMKTLAQELAPHRIRVNTVNPTQVDTPMIMNDAMYRLFCPDIDEPTREDFAPLSQA
MNALPIPWVESVDVSNAVLFLASDEARYITGVALPVDAGVLVK
NT seq 852 nt   +upstreamnt  +downstreamnt
gtgaccaccacagcacgcaccaccggaagggtttcgggcaaggtcgcgttcgtcaccggc
gcagcacgcggccagggccgggcacatgcgatccgcttggccgaggaaggcgcagacatc
atcgcgctcgacatctgctccgacatcggaggtgttccgtactcgctggcaagcgaagcc
gacctcgccgagaccgtccggtcggtcgaggccgtcggcgggcgaattctggccgaggtg
gccgatgttcgcgacttcaccgcggtcaagggtgtcctggaccgcggggtcgtccagttc
ggtcatgtcgacatcgtctgcgccaacgtcggtatcaacatcccctcacctacacacgaa
ctcaccgaaagccaatggggcactgtcgtcgacatcgatctcagcggcacgtggcgaacc
gccaaagccgcgatcccctacctcatcgaacaagggggcgggggcgcaatcatcctgacc
agttcggcggcggggctcaagggatacggcaacatcgcgcactacacagccgcgaaacac
ggcgtcaacggattgatgaaaactctcgcgcaggaactggctccccaccgaatccgcgtg
aataccgtgaaccccacccaggtcgacactccgatgatcatgaacgacgccatgtacagg
ttgttctgtcccgacatcgacgaaccgactcgtgaggacttcgccccgctgtcgcaagcg
atgaatgcgctacctatcccgtgggtcgaatccgtcgacgtcagcaatgccgtgcttttc
ctcgcgtccgacgaagccaggtacatcaccggcgtcgcactgcccgtcgacgcaggcgta
ctcgtcaaatag

DBGET integrated database retrieval system