KEGG   Rhodococcus erythropolis PR4: RER_09250Help
Entry
RER_09250         CDS       T00881                                 

Definition
(GenBank) putative acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00071  Fatty acid degradation
rer00072  Synthesis and degradation of ketone bodies
rer00280  Valine, leucine and isoleucine degradation
rer00310  Lysine degradation
rer00362  Benzoate degradation
rer00380  Tryptophan metabolism
rer00620  Pyruvate metabolism
rer00630  Glyoxylate and dicarboxylate metabolism
rer00640  Propanoate metabolism
rer00650  Butanoate metabolism
rer00900  Terpenoid backbone biosynthesis
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01200  Carbon metabolism
rer01212  Fatty acid metabolism
rer02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RER_09250
   00630 Glyoxylate and dicarboxylate metabolism
    RER_09250
   00640 Propanoate metabolism
    RER_09250
   00650 Butanoate metabolism
    RER_09250
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RER_09250
   00072 Synthesis and degradation of ketone bodies
    RER_09250
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RER_09250
   00310 Lysine degradation
    RER_09250
   00380 Tryptophan metabolism
    RER_09250
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RER_09250
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RER_09250
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RER_09250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rer04147]
    RER_09250
Enzymes [BR:rer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RER_09250
Exosome [BR:rer04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RER_09250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C Phage_lysis ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAH31633
NITE: RER_09250
UniProt: C0ZR83
Position
complement(1018310..1019473)
Genome map
AA seq 387 aa AA seqDB search
MGTPVIVEAVRTPIGKRGGWLAGLHAAEILGAAQKGVLDRSGIDPLLIEQVIGGCVTQAG
AQSNNITRTAWLHAGLPWQTGATTVDCQCGSAQQANHLIAGLIATGAIDAGIACGIEAMS
QVPLGANVGDQAGPRRPATWDIDMPNQFEAAERIARRRGLTRDDIEALGVRSQALAKQAW
EEGRFDREVLELSAPQVDKEGNLTGETKLVNRDQGLRDTTAESLARLKPVLEGGIHTAGT
SSQISDGAAAVLLMDEDKARALGLKPRARIIAQALVGSEPEFHLDGPVQATSRVLEKSGM
KIGDLDLFEINEAFASVALSWAQVHEPDFDNVNVNGGALALGHPVGSTGSRLITTALHEL
ERRNGSTALITMCAGGALATGTIIERI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgggcacaccagtaatcgtcgaggctgtccgtacaccgatcggcaagcgcggaggttgg
ctcgccggtctgcacgccgccgagatcctcggagcggcacaaaagggcgttctcgaccgg
tcgggaatcgacccgttgctgatcgagcaggtgatcggcggctgcgtcacccaggccggc
gctcagtccaacaacatcacgcgcacggcttggctgcacgccggacttccgtggcagacc
ggcgcaaccaccgtggactgccagtgcggttcggcccagcaggcgaaccatctgatcgcc
ggtctgatcgccaccggcgccatcgacgccggcatcgcctgcggcatcgaagccatgagc
caggttcccctcggcgcaaacgtcggcgatcaggccggaccgcgtcggcctgcgacgtgg
gacatcgacatgcccaaccagttcgaagcagcggaacgcatcgcgcgtcgacgcggactg
acccgtgacgacatcgaagccctcggcgtccgctcgcaggcgctggccaagcaggcctgg
gaggaagggcgtttcgaccgcgaggttctcgaactttcggcgccccaggtcgacaaggaa
ggaaacctcacgggcgagaccaagctcgtcaatcgcgatcagggcctgcgcgatacgacg
gccgagtccctagcccgattgaagcccgtcctcgaaggcgggattcacacggccggaacg
tcttcccagatctccgacggcgcggccgcagtcctgctcatggacgaggacaaggctcgc
gcactcgggttgaagccgcgagcccgcatcatcgcccaggccctggtcggctcggaaccg
gaattccacctcgacggaccggtgcaggcaaccagccgtgtcctggagaagagcggaatg
aagatcggcgacctcgatctgttcgagatcaacgaagcattcgcatccgtcgcactgtcc
tgggctcaggttcacgaacccgacttcgacaacgtcaatgtcaacggcggcgcgctcgct
ctcggccatccggttggcagcacgggctctcgactgatcaccaccgcactgcacgaactc
gagcgtcgcaacggctcgaccgctctgatcacgatgtgcgccggcggcgcgctggccacc
ggaaccatcatcgagcgtatctga

DBGET integrated database retrieval system