KEGG   Rhodococcus erythropolis PR4: RER_09510Help
Entry
RER_09510         CDS       T00881                                 

Gene name
nagA
Definition
(GenBank) probable N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00520  Amino sugar and nucleotide sugar metabolism
rer01100  Metabolic pathways
rer01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RER_09510 (nagA)
Enzymes [BR:rer01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     RER_09510 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: BAH31659
NITE: RER_09510
UniProt: C0ZRA9
Position
1045560..1046744
Genome map
AA seq 394 aa AA seqDB search
MTLRGQILRGQLVTGGRLLSDGVVEISGDRVVWAGPASQRTDPLPERAAAGTTIIPGLVD
VHCHGAGGFGFPEADEFGSTVAADHHRTNGTTSVIGSLVSAPPQILRSRIELLAGLVDEG
TLAGIHLEGPFLSVLRCGAQDPDSILDGDPALLESLLEAGRGHIRSMTIAPETAHFDELA
SLLERHGAVVSIGHTDASNPIATRSIAHSAHAPLSATHLFNGMAPMHHRAPGAVAACLAA
AAKGQMVVELVGDGVHLADETVATVFDLVGPHQIALVSDAMAAAGMPDGRYPLGPLDVDV
VGGVARLAGQGETAIAGGTSRLMDIVRRAVNHAGVDLLSAVIAATATPASLMGLAGMVGD
LVPGCRADLIVTGPELETRAVMAAGNWLMNYTES
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgacacttcgtggacaaattctgcgtggacaattggtgaccggtggtcgattgctctcg
gatggggttgtcgagatctccggtgatcgtgtggtgtgggccggacccgcgtcgcagcga
accgacccgttacccgaacgggcagctgcgggaacaacgatcattccgggtttggtcgac
gttcactgccacggcgccggcggattcggtttccccgaggcagacgagttcggatcaacc
gtggctgccgatcaccatcggacgaacggcacgacctcggtgatcggctcgctcgtctcc
gcgccgccgcagatcctgcgcagtcgcatcgagctcctggcaggactggtggacgagggc
acgctggccggaattcacctggaaggtccattcctttcggtacttcgttgtggcgcccag
gatcccgacagcattctcgacggcgacccggctctgctcgagtcgctgctggaagccggc
cgtgggcacattcgctcgatgacgatcgctccggagacagcacacttcgacgaacttgcc
tcattgctggagcgtcacggtgccgtcgtgagtatcggacacaccgatgcgtccaacccg
attgcgacacgttcgatcgcacactcggcgcatgcaccgctcagtgccactcacctgttc
aacggtatggctccgatgcatcaccgtgctcccggcgcagtggcggcatgtcttgccgcg
gctgcgaaaggacagatggtggtcgagttggtcggggacggagtacatctggccgacgag
acggtagcgacggtgttcgatcttgtcggtccgcatcagatcgcgttggtctccgacgcg
atggctgccgccggaatgcccgacggccgttacccgctcgggcctctcgacgtcgacgtg
gtcggtggcgtggcgcgattggccggccagggggaaacggccattgccggcgggacgagt
cggttgatggacatagtccgccgggctgtcaatcacgccggcgtcgatctgctttcggct
gtcatcgcagcgacggcaacgcctgcttcgctgatggggctggccggaatggtcggcgat
ctcgtgccgggttgccgcgccgatctgatcgtcaccggtccagaactcgaaacccgcgcc
gtcatggccgctgggaactggctcatgaactacaccgaaagctga

DBGET integrated database retrieval system