KEGG   Rhodococcus erythropolis PR4: RER_14280Help
Entry
RER_14280         CDS       T00881                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00230  Purine metabolism
rer00250  Alanine, aspartate and glutamate metabolism
rer01100  Metabolic pathways
Module
rer_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rer00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RER_14280 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RER_14280 (purA)
Enzymes [BR:rer01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     RER_14280 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: BAH32136
NITE: RER_14280
UniProt: C0ZTG3
Position
1560959..1562248
Genome map
AA seq 429 aa AA seqDB search
MPAIVLIGAQWGDEGKGKATDLLGEQLQWVVRYQGGNNAGHTVVLPNGDKFALHLIPSGI
LTPAVNNVIGNGVVVDPGVLLTELAGLEERGVDTSRLLLSADAHLIMPYHVAIDKVTERF
LGAKKIGTTGRGIGPCYQDKIARVGVRAADVLDEKILTQKVEAALEFKNQVLVKIYNRKA
LDPQQVVEEVLTQAEGFKHRISDTRLELNLALERGETVLLEGSQGTLLDVDHGTYPYVTS
SNPTSGGAAVGSGIGPTKITTVLGILKAYTTRVGSGPFPTELFDDHGAYLAKQGGEVGVT
TGRARRTGWFDAVIARYATRVNGITDYFLTKLDVLSSLDTVPICVAYEVDGVRHDEMPMS
QSDIHHAKPIYEEMPGWWEDISEARTFEELPQNAQNYVLRLEELSGAFISCIGVGPGRDE
TIVRREIVR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgccggcaatcgtcctgatcggcgcccagtggggcgacgaaggtaagggcaaagctaca
gatctactgggcgagcagcttcagtgggtcgtgcgataccagggcggtaacaacgccgga
cacaccgtggttctgccgaacggtgacaagttcgcactgcacctcatcccgtccggaatc
ctcacccccgccgtcaacaacgtcatcggtaacggtgtcgtcgtcgacccgggtgtgttg
ctgaccgaattggcaggcctggaagagcgcggtgtcgacacgtcccgcctgttgctctct
gctgatgcgcacctgatcatgccgtaccacgtggccatcgacaaggtcaccgaacgcttc
ctgggagcgaagaagatcggcacgaccggccgcggtatcggcccgtgctaccaggacaag
atcgcccgtgtcggtgtccgtgctgcggacgtcctggacgagaagatcctgacccagaag
gtcgaagcggcactcgaattcaagaaccaggtgctggtcaagatctacaaccgcaaggca
ctcgacccgcagcaggtcgtcgaagaggtactgacgcaggccgagggtttcaagcaccgc
atctcggacacgcgcctggagctcaaccttgccctcgagcgcggcgagaccgtcttgctc
gaaggttcgcagggcactctgctggacgtcgaccacggcacgtacccgtacgtgacctcg
tccaaccccacctcgggtggtgcggcggtcggttcgggcatcggtcccaccaagatcacc
acggtgctcggaatccttaaggcgtacacgacgcgtgtcggttccggtccgttcccgacg
gagctgttcgacgatcacggcgcatacctggcgaagcagggcggcgaggtcggtgtcacc
accggacgcgctcgtcgtacgggatggttcgacgctgtcatcgcgcgttacgcgacgcgc
gtcaacggcatcaccgactacttcctcaccaagctggacgtgctgagcagtctcgacacc
gtgccgatctgtgtcgcgtacgaggtggacggtgtccgccacgacgaaatgccgatgtcg
cagagcgacattcaccacgccaagcccatctacgaagagatgccaggctggtgggaggac
atctcggaggctcgcaccttcgaggaactgccgcagaatgcgcagaactacgtgcttcgg
ctcgaagagctttcgggtgcgttcatctcctgcatcggtgtcggtcccggccgcgacgag
acgatcgtccggcgcgagatcgtccgctag

DBGET integrated database retrieval system