KEGG   Rhodococcus erythropolis PR4: RER_37740Help
Entry
RER_37740         CDS       T00881                                 

Definition
(GenBank) putative phosphoglycerate mutase family protein
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
rer  Rhodococcus erythropolis PR4
Brite
Enzymes [BR:rer01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     RER_37740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAH34482
NITE: RER_37740
UniProt: C1A1J7
Position
complement(4119071..4119745)
Genome map
AA seq 224 aa AA seqDB search
MTSSAPSAASNPVRRLILLRHGQTEYNADSRMQGQLDTDLSELGRTQAKSAGPVIADRRP
LTIVSSDLRRAYFTAVAVGDAAGLPVLTDTRLRETHLGEWQGLTHHDVDERTPGVRSAWR
ADATLAPPGGESRIDVANRSLPVVHELLDTHPDWAERPVVLVAHGGLIAALTAALLDLPV
DRWAVLGGLGNTSWVQLSGHGDVKSIEWRLDVWNASASVANDVL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcgtcggcgcccagtgcggcgtcgaaccctgtccgccgactcatcctgctgcgt
cacggacagaccgaatacaacgccgactctcggatgcaggggcaactcgacaccgacctg
tcggagttgggacgcacgcaggccaagagtgcaggtccggtgatcgccgatcgcagaccg
ttgacgatcgtgtcctcggatctgcggcgcgcgtatttcacggcagtcgctgtcggtgac
gccgccggacttccggtcctcaccgacacgcgtctgcgtgagacacacctgggtgaatgg
caaggcctgactcatcatgacgtcgacgagcgcactcccggtgtgcgatctgcctggcgg
gcggatgccacgttggcgccgcccggcggcgaaagccgaatcgacgtcgcgaatcgcagc
ctccccgtagttcacgaattgctcgacacgcacccggactgggccgagcggcccgtagtt
ctggtggcgcacggaggcttgatcgcggcactgacagcggcattgctcgacttacccgtc
gatcgctgggccgtcctcggcggattgggaaacaccagttgggtgcaactcagcggacac
ggtgacgtcaagtcgatcgagtggcgactcgacgtatggaatgcttctgcgagtgtcgca
aatgacgtcctctga

DBGET integrated database retrieval system