KEGG   Rhodococcus erythropolis PR4: RER_37940Help
Entry
RER_37940         CDS       T00881                                 

Gene name
rplU
Definition
(GenBank) 50S ribosomal protein L21
  KO
K02888  large subunit ribosomal protein L21
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rer00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RER_37940 (rplU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rer03011]
    RER_37940 (rplU)
Ribosome [BR:rer03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RER_37940 (rplU)
  Bacteria
    RER_37940 (rplU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L21p CvfB_WH
Motif
Other DBs
NCBI-ProteinID: BAH34502
NITE: RER_37940
UniProt: C1A1L7
Position
complement(4139451..4139762)
Genome map
AA seq 103 aa AA seqDB search
MATYAIVKTGGKQYKVAVGDLVKVEKIEGEPGTAVSLAPVLVVDGSDLTTDAAKLAKVAV
TSEIVEHTKGPKIRIHKFKNKTGYHKRQGHRQPITVLKVTGIK
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtacgcgatcgtcaagaccggcggaaagcagtacaaggtcgctgttggtgac
ctcgtcaaggtcgagaagatcgagggtgagcccggcactgctgtctcgcttgctcccgtt
ctcgtggtcgacggatctgacctgaccaccgacgcggccaagctggccaaggtcgcagtc
accagtgagatcgtcgagcacaccaagggcccgaagatccgcatccacaagttcaagaac
aagaccggttaccacaagcgtcagggccacaggcagccgatcacggtgctcaaggtcacg
ggcatcaagtaa

DBGET integrated database retrieval system