KEGG   Rhodococcus erythropolis PR4: RER_39940Help
Entry
RER_39940         CDS       T00881                                 

Definition
(GenBank) putative dihydrolipoamide acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00010  Glycolysis / Gluconeogenesis
rer00020  Citrate cycle (TCA cycle)
rer00620  Pyruvate metabolism
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01200  Carbon metabolism
Module
rer_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_39940
   00020 Citrate cycle (TCA cycle)
    RER_39940
   00620 Pyruvate metabolism
    RER_39940
Enzymes [BR:rer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RER_39940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: BAH34702
NITE: RER_39940
UniProt: C1A267
Position
4377485..4378720
Genome map
AA seq 411 aa AA seqDB search
MSTGHEFRLPDLGEGLTSADLVEWTVGVGDTVELNQVLAQVETAKALVELPSPYVGVVRE
LLVEPGSTVPVGTPIIRIEEPADSPSPSDSQSPSVLVGYGPAAERPSRRRNRVTPHSQTA
ASTERRPATPSARRAAREAGIDLSEITGSGFDGAVTAADVADALRVKAASNEAPRPAGSG
MQKQPVSSGMRKQMASAMVASTRAPQASVFLTADVTPSMELLGRLRPSDAFTGLSLTPLT
LAAKALVTAISSHPMVNAHWDEARGDAVIDDHVNLGIAVASERGLSVPNIKSAETLSLVQ
LARAVTELTVAARAGVTDVHHLTGGTVTITNVGVFGVDGGIPLLNPGEAVILCLGTVSER
PWVIERKIEARSVATLTLTFDHRILDGEQAARFLSFVAQMLADPDLLLSHL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagggcacgaattccggttgccggatctcggcgagggcctgacgtccgccgat
ctggtcgagtggacggtcggcgtcggcgacacggtggaactcaatcaagttctcgcccag
gtagagacagccaaggctctcgtcgaactgccgtcgccctacgtcggcgttgtcagagaa
ctcctcgtcgaacctggctctaccgtcccggtcggcactccgatcatccgtatcgaggag
cctgcagattcaccgtctccaagtgattcacagtctccgagcgtgcttgtcggatacgga
cccgcggccgagagaccgagccgacgacggaaccgggttacgccacactcgcaaaccgcg
gcgagtaccgagcgtcggcccgcaacaccctcggcgcggcgcgcggcccgcgaagccggc
atcgatctgagcgaaatcaccggaagtggattcgacggtgccgtcacggcagcggacgtc
gcagacgcgcttcgcgtgaaggccgcgtcgaatgaagctccgcggccggccggatccggt
atgcagaaacagccggtctcgtccggcatgcggaaacagatggcgtcggcgatggtcgcc
agtacccgtgcccctcaggccagcgtcttcctcaccgccgatgtcacgccttcgatggaa
ctactcggcaggctccgtccctcggacgcattcaccggactttctctcactccgctgact
ctcgcggccaaggccttggttacggcgatctcgtcgcacccgatggtgaacgcgcattgg
gacgaggcccgcggcgacgccgtcatcgacgatcacgtgaatctcggcatcgccgtcgcc
tccgaacgtggactgtccgtgcccaacatcaaaagcgccgagacgctgagcctggtccaa
cttgcacgcgcggtgaccgaactgaccgtcgctgcccgcgcgggagtgaccgatgtccat
cacctgaccggtggcaccgtcacgatcaccaatgtcggagtcttcggcgtcgacgggggc
attccgctcctcaatccgggagaagccgtcatcctttgcctgggcacagtgagcgagcgt
ccctgggtaattgagcgcaagatcgaagcgcggagcgtcgcgacactgacgttgacgttc
gaccaccggatactcgatggtgagcaggccgcgagattcctctcatttgtcgcacagatg
ctcgcggacccggacctgttgctgtctcacctgtaa

DBGET integrated database retrieval system