KEGG   Rhodococcus erythropolis PR4: RER_42650Help
Entry
RER_42650         CDS       T00881                                 

Gene name
metB
Definition
(GenBank) probable cystathionine gamma-synthase/cystathionine gamma-lyase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00270  Cysteine and methionine metabolism
rer00450  Selenocompound metabolism
rer00920  Sulfur metabolism
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01130  Biosynthesis of antibiotics
rer01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RER_42650 (metB)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RER_42650 (metB)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    RER_42650 (metB)
Enzymes [BR:rer01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     RER_42650 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Met_gamma_lyase Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1 Alliinase_C
Motif
Other DBs
NCBI-ProteinID: BAH34973
NITE: RER_42650
UniProt: C1A2Y8
Position
complement(4681784..4682956)
Genome map
AA seq 390 aa AA seqDB search
MSEQRSKADNISWQGFSTKAVHAGYEPDPLTGAVNVPIYASSTFAQDGVGGMRSGFEYAR
TGNPTRRPLEANLAALESGTYGRAFSSGMAATDCLLRSVLRPGDHLVIPDDAYGGTFRLI
DKVFTQWGIEYTPAPVSDVDAVRAAMKSNTKLVWVETPTNPLLNIGDIELLAEVAHEGNA
KIVVDNTFASPYLQQPLQLGADIALHSTTKYIGGHSDVVGGALVCNDEELDTAFAFLQNG
SGGVPGPFDAFLTLRGIKTLALRMERHSDNAEKVVELLDGHPAVASVIYPGLASHPSHKV
AAKQMRRFGGMISVRLKGGKAAALDLCSRTEIFTLAESLGGVESLIEFPGAMTHASTAGS
ALEVPDDLVRLSVGIEDASDLVGDIEQALS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaacgcagcaaggccgacaacatcagctggcagggtttctccacgaaagcg
gtgcatgcgggttacgaacccgatccgctgaccggcgcggtcaacgtgccgatctacgca
agttccaccttcgcccaagacggcgtcggtggaatgcgcagtggcttcgagtacgcgcga
acgggcaaccccacccgtcgcccgctcgaggcgaaccttgccgcgctcgaatccggaacc
tacggccgagcgttcagttcgggaatggcggccaccgactgcctgctccgttcggtactt
cgaccgggcgatcacctggtcatccccgacgacgcgtatggcggaaccttccgtctcatc
gacaaggtgttcacgcagtgggggatcgagtacaccccggctccggtgtccgacgtcgat
gcggtgcgcgcggcgatgaagtccaacaccaagctggtctgggtcgagacgcccacgaac
ccgctgctcaatatcggtgacatcgagctccttgccgaggtcgcccacgagggcaacgca
aagatcgtggtggacaacaccttcgcgtcgccgtacctgcagcagccgctgcagctcggt
gccgacatcgcgctgcactccacgaccaagtacatcggcggacactccgacgtggtcggt
ggcgctctcgtctgcaacgacgaagaactggataccgcgtttgccttcctgcagaacgga
tccggcggcgttcccggcccgttcgacgcgttcctgacgttgcgcggaatcaagacactg
gcgctgcgcatggagcgtcacagtgacaacgcggagaaggtcgtcgaattgctcgacggc
caccccgcggttgccagcgtcatctacccgggcctggcttcgcatccgtcacacaaggtc
gcggccaagcagatgcgacgcttcggcggcatgatctccgtccgcctcaagggcggcaag
gcggcagctctcgacctgtgctcgcgcaccgagatcttcacgctggcagaatctctcggc
ggcgtcgaatctctcatcgagttccccggcgcgatgacccacgcctcgacggccggttcc
gctctcgaggttcccgacgatctggttcgcctgtcggtcggcatcgaagacgcctccgat
ctggtcggcgacatcgagcaagcgctgtcctga

DBGET integrated database retrieval system