KEGG   Rhodococcus erythropolis PR4: RER_42680Help
Entry
RER_42680         CDS       T00881                                 

Definition
(GenBank) putative beta-ketoadipyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00071  Fatty acid degradation
rer00072  Synthesis and degradation of ketone bodies
rer00280  Valine, leucine and isoleucine degradation
rer00310  Lysine degradation
rer00362  Benzoate degradation
rer00380  Tryptophan metabolism
rer00620  Pyruvate metabolism
rer00630  Glyoxylate and dicarboxylate metabolism
rer00640  Propanoate metabolism
rer00650  Butanoate metabolism
rer00900  Terpenoid backbone biosynthesis
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01200  Carbon metabolism
rer01212  Fatty acid metabolism
rer02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RER_42680
   00630 Glyoxylate and dicarboxylate metabolism
    RER_42680
   00640 Propanoate metabolism
    RER_42680
   00650 Butanoate metabolism
    RER_42680
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RER_42680
   00072 Synthesis and degradation of ketone bodies
    RER_42680
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RER_42680
   00310 Lysine degradation
    RER_42680
   00380 Tryptophan metabolism
    RER_42680
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RER_42680
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RER_42680
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RER_42680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rer04147]
    RER_42680
Enzymes [BR:rer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RER_42680
Exosome [BR:rer04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RER_42680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: BAH34976
NITE: RER_42680
UniProt: C1A2Z1
Position
4685551..4686768
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVSAVRSPIGRAMKGSLKDIRPDDLATQMVAAALAKIPELDPTEIDDLMLGCGQP
AGQSGFNIARVVAVQLGYDFLPGVTVNRYCSSSLQTTRMALHAIRAGEGDVFISAGVESV
SSFITGNADGLPNTKNPLFDAAQARSAKLAEGGVAWTDPREEGLIPDVYLGMGQTAENVA
SATGITREDQDRWAVRSQNRAEEAIARGFFEREITPVTLADGTVVSKDDGPRAGTTYEGI
SGLKPVFRPDGTVTAGNACPLNDGAAALVIMSDTKAKALGLTPLARIVSTGVSGLSPEIM
GLGPIQAVKNALKIAGKSISDIDLFEINEAFAVQVLGSARELGIEEDKLNISGGAIALGH
PFGMTGARITNTLINNLQEQDKTFGVETMCVGGGQGMAMVIERLS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggcagtaatcgtctcagcagtacggtcgcccatcggccgcgcaatgaagggt
tcgctcaaggacatccgcccggatgacctcgcaactcagatggttgccgccgcgttggca
aagatccccgagctcgaccccaccgagatcgacgacctcatgctcggttgcggccagccc
gccggacagtcgggcttcaacatcgcccgcgtcgtcgccgttcagctcggctacgacttc
ctccccggtgtgacggtcaaccgttactgttcctcctcgctgcagaccacccgtatggca
ctgcacgccatccgcgcaggcgagggcgacgtcttcatctccgccggcgtcgagtccgtc
tccagtttcatcacgggcaacgccgacggcctacccaacaccaagaacccgctcttcgac
gcagcgcaggctcgtagcgccaagctcgccgagggtggagtcgcctggaccgatcctcgc
gaagaaggcctgatccccgacgtgtacctgggcatgggccagaccgccgagaacgtcgct
tcggccaccggcatcacccgcgaagaccaggaccgctgggcagtgcgcagccagaaccgc
gccgaggaagccatcgctcgcggcttcttcgagcgtgaaatcacgcccgtcaccctcgcc
gacggcactgtcgtctccaaggacgacggcccccgcgccggcaccacctacgagggcatc
agcggcctcaagcccgtcttccgccccgacggcaccgtcaccgccggcaatgcctgcccg
ctcaacgacggcgcagccgcactggtgatcatgtccgacaccaaggcgaaggcactcggc
ctgaccccgctggctcgcatcgtctccaccggcgtctcgggcctgtcccccgagatcatg
ggcctcggcccgatccaggccgtcaagaacgccctgaagatcgccggcaagtcgatctcc
gacatcgacctgttcgagatcaacgaggcattcgccgtgcaggtcctcggatccgctcgc
gaactaggcatcgaagaggacaagctcaacatctccggtggcgcgatcgccctgggtcac
cccttcggtatgaccggtgcccgcatcaccaacaccctgatcaacaacctgcaggagcag
gacaagaccttcggcgtcgagaccatgtgtgtcggcggcggacagggcatggcaatggtg
atcgagcgcctcagctga

DBGET integrated database retrieval system