KEGG   Rhodococcus erythropolis PR4: RER_43480Help
Entry
RER_43480         CDS       T00881                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00071  Fatty acid degradation
rer00072  Synthesis and degradation of ketone bodies
rer00280  Valine, leucine and isoleucine degradation
rer00310  Lysine degradation
rer00362  Benzoate degradation
rer00380  Tryptophan metabolism
rer00620  Pyruvate metabolism
rer00630  Glyoxylate and dicarboxylate metabolism
rer00640  Propanoate metabolism
rer00650  Butanoate metabolism
rer00900  Terpenoid backbone biosynthesis
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01200  Carbon metabolism
rer01212  Fatty acid metabolism
rer02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RER_43480
   00630 Glyoxylate and dicarboxylate metabolism
    RER_43480
   00640 Propanoate metabolism
    RER_43480
   00650 Butanoate metabolism
    RER_43480
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RER_43480
   00072 Synthesis and degradation of ketone bodies
    RER_43480
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RER_43480
   00310 Lysine degradation
    RER_43480
   00380 Tryptophan metabolism
    RER_43480
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RER_43480
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RER_43480
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RER_43480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rer04147]
    RER_43480
Enzymes [BR:rer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RER_43480
Exosome [BR:rer04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RER_43480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAH35056
NITE: RER_43480
UniProt: C1A371
Position
4782154..4783644
Genome map
AA seq 496 aa AA seqDB search
MMVDASRIPVIVGVGDLRWNPADRHREPLDLIHDATVAALNDSGHAELGTQIDSVFAIKT
VSWSYNDLPGLLASRLGATPTVTSTSPIGGHWPAALLDRIGAAIARGESSAALLVGGESH
ASSTALRKSGVAPDSIGWTAAPGGPPGFDPTDLGSPEMQRAGFIVPTRVYPLFENCFSAA
EGHDARESLDWSARMYAAFSELASKNPASWTSEIRSADEIGTVGPGNRMVSEPYPLMLNA
MPFVNQAAAVVVCSLSTAREFGIDESKLVYLWGGAGASDPLDILSRNSFDSSAAMHDAVH
RALDGAGVGADALDIVDAYSCFPIVPKLLIRELGLPDTAIPSVTGGHSFFGGPLNSYTLH
SVAEVTRRIRDGANLALVHGNGGFLTYQHCVLLSSTAHADGYVGDPDARALTAEAPELIT
DYTGTAEIVTASVEYGRTGEPEIGFVIAATPDGRRVAGHTGPENAAELTQLRGDNPAAIG
RTVHISDENGKLTLTF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgatggttgacgcatcacgaatcccggtcatcgtcggcgtcggcgatctgcgctggaat
cctgccgacaggcaccgcgaacccctcgatctgattcacgacgccaccgtcgccgcgtta
aacgacagtggacacgctgaactgggaacacagatcgattccgtgttcgcgatcaagaca
gtcagctggtcgtacaacgatctccccggactactcgcctcacgattaggcgcgaccccc
acggtcacctctacctcgccgatcggtggccactggcccgcggcgctcctcgatcggatc
ggcgcggccatcgctcgcggtgaatcctcggctgctctgctcgtgggcggcgaatcgcac
gccagcagtaccgccctgcgaaagtccggagtcgcccccgactcgatcgggtggacagcc
gcgcccggtgggcctcccggattcgatccgaccgacctgggaagccctgaaatgcagcgc
gccggtttcatcgtgcctacgcgcgtctacccgctcttcgagaactgtttcagcgctgcc
gagggccacgacgcccgtgaatcgctcgactggtccgcgcggatgtacgccgcattctcg
gaactggcttcgaagaatcccgcctcctggacgtcggagatccgatcggcagacgagatc
ggcaccgtcggccccggcaatcggatggtctccgagccgtacccgctgatgctcaacgcc
atgcctttcgtcaatcaggctgcggccgttgtcgtctgctcgttgtcgacggcccgtgag
ttcgggatcgatgaaagcaaactggtgtacctctggggcggcgctggtgcgagtgatccg
ttggacatcctcagccgcaacagcttcgacagctcagccgcgatgcatgacgccgtacat
cgcgcactcgatggtgccggagtcggcgccgacgcactcgacatcgtcgatgcctacagc
tgcttcccgatcgtgcccaagctgttgatccgcgaactcggacttcccgataccgcgatc
ccaagcgtcaccggaggacactcgttcttcggcggaccgctcaacagctacaccctgcat
tccgtcgctgaagtcaccaggcgaatacgcgacggcgcgaaccttgccctcgtccacggc
aacggtggattcctcacctaccagcactgcgtactgctgtcgtccaccgctcatgccgac
gggtacgtcggtgatcccgacgcacgcgctttgaccgcggaggctccggaactgatcact
gattacacgggcacggcggaaattgtcactgcctctgtcgaatacggtcgcaccggggag
cctgagatcgggttcgtgatcgcggcaacgccggacggccgccgcgtcgccggtcacacc
ggtcccgagaatgccgccgaactgacccagcttcgcggtgacaacccggcggcgatcggg
cggaccgttcatatcagcgacgagaacgggaagctcacgctcacgttctga

DBGET integrated database retrieval system