KEGG   Rhodococcus erythropolis PR4: RER_43670Help
Entry
RER_43670         CDS       T00881                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00450  Selenocompound metabolism
rer00970  Aminoacyl-tRNA biosynthesis
rer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rer00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RER_43670 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RER_43670 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rer01007]
    RER_43670 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rer03016]
    RER_43670 (metG)
Enzymes [BR:rer01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RER_43670 (metG)
Amino acid related enzymes [BR:rer01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RER_43670 (metG)
Transfer RNA biogenesis [BR:rer03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RER_43670 (metG)
 Prokaryotic type
   Other AARSs
    RER_43670 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: BAH35075
NITE: RER_43670
UniProt: C1A390
Position
4802479..4804077
Genome map
AA seq 532 aa AA seqDB search
MTVPASPSQTPRPDSAAPEGAERSPFYITTAIAYPNGAPHIGHAYEYISSDALARFKRLD
GHEVFFMTGTDEHGLKMQQTAIKEGIDVRELAARNSDVFQNLDKVLNISYDRFIRTTDAD
HQVASKAIWEKMAASGDIYLDTYSGWYSVRDEAFYTESETTLLEDGTRQSTETGTPVEWT
EESNYTFRLSAYGERLLALYEEHPEFIAPTTRRNEIVSFVKGGLKDISISRTTFDWGVKV
PGDPDHVMYVWVDALTNYLTGVGYPNVDSEEFKKFWPASLHIIGKDITRFHTVYWPAFLM
SAGIELPERVFVHGFLYNKGEKMSKSVGNVVDPIAMVDQYGLDAVRFFLLREISYGQDGS
YSHEAIVTRMNADLSNELGNLAQRSLTMVAKNCDAQVPTPGEFTEDDLAMLASADALLAK
CRSEFDVQALHLALEAIWGVLGETNRYFSKQEPWVLRKTDPARMATVLYVTLEVVRIVGL
LVQPVMPDAASRILDLLGQSEENRQFADIAVRIDANRKLPAPAPVFPRFVEE
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgcctgcctcaccctcccagaccccgcgcccggactccgccgccccggaaggc
gcggaacgatcgccgttctacatcacgactgcgatcgcgtatcccaacggcgctccgcac
atcggccacgcgtacgagtacatctcttcggacgcgctcgcccgcttcaagcgcttggac
ggtcatgaagtgttcttcatgaccggtaccgacgagcacggtctgaagatgcagcagaca
gcgatcaaagagggcatcgacgtacgcgaactcgcggctcgaaactccgacgtgttccag
aacctcgacaaggtcctgaacatctcgtacgaccggttcatccgcaccacggacgctgat
caccaggtcgccagcaaggcgatctgggagaagatggccgcatcgggcgacatctacctc
gacacgtactcgggttggtactcggttcgggacgaggccttctacaccgaatccgagacc
acgcttctggaggacggcacccgtcagtccaccgagaccggcaccccggtggagtggacc
gaggagtcgaactacaccttccgtctctcggcgtacggggagcgtctcctcgcgctgtac
gaagagcaccccgaattcatcgcccccacaacacgccgcaacgagatcgtcagcttcgtc
aagggcggcctcaaggacatctcgatctcgcgcaccacgttcgactggggcgtcaaggtc
ccgggcgacccggaccacgtcatgtacgtctgggtagacgccctcaccaactatctgacc
ggtgtgggttacccgaacgtcgattcggaggagttcaagaagttctggcccgcgagcctg
cacatcatcggcaaggacatcacgcggttccacaccgtgtactggccggcattcctcatg
tctgccggcatcgaactgccggagcgggtgttcgtccacggcttcttgtacaacaagggc
gagaagatgtcgaagtccgtcggcaacgtcgtcgaccccatcgcgatggtcgatcagtac
ggcctcgacgccgtccgtttcttcttgctccgcgagatctcgtacggtcaggacggcagc
tacagccacgaagcgatcgtgacgcgcatgaatgctgatctctcgaacgaactcggcaat
ctcgcgcagcgttcgctgacgatggtcgcgaagaactgcgacgcccaggtacccaccccc
ggtgagttcaccgaggacgacctggcgatgctggcatcggcggatgccctgctcgccaag
tgccgcagcgagttcgacgtgcaggctctacacctcgcgctggaagccatctggggcgtg
ctcggcgagaccaaccggtacttctccaagcaggaaccgtgggttctgcgtaagaccgat
ccggcacgcatggcgacggttctgtacgtgacgctcgaagtggtccgtatcgtcgggctt
ctcgttcagccggtgatgcccgacgcggcgtcacgcatcctcgatctgctcggccagagc
gaagagaaccgacagttcgccgacatcgcggtacgcatcgacgcgaaccggaaactgcct
gctccggcgccagttttcccccgcttcgtcgaggaatga

DBGET integrated database retrieval system