KEGG   Rhodococcus erythropolis PR4: RER_56000Help
Entry
RER_56000         CDS       T00881                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00071  Fatty acid degradation
rer00280  Valine, leucine and isoleucine degradation
rer00281  Geraniol degradation
rer00310  Lysine degradation
rer00360  Phenylalanine metabolism
rer00362  Benzoate degradation
rer00380  Tryptophan metabolism
rer00410  beta-Alanine metabolism
rer00627  Aminobenzoate degradation
rer00640  Propanoate metabolism
rer00650  Butanoate metabolism
rer00903  Limonene and pinene degradation
rer00930  Caprolactam degradation
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01212  Fatty acid metabolism
Module
rer_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RER_56000
   00650 Butanoate metabolism
    RER_56000
  Lipid metabolism
   00071 Fatty acid degradation
    RER_56000
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RER_56000
   00310 Lysine degradation
    RER_56000
   00360 Phenylalanine metabolism
    RER_56000
   00380 Tryptophan metabolism
    RER_56000
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RER_56000
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RER_56000
   00281 Geraniol degradation
    RER_56000
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RER_56000
   00627 Aminobenzoate degradation
    RER_56000
   00930 Caprolactam degradation
    RER_56000
Enzymes [BR:rer01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RER_56000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAH36308
NITE: RER_56000
UniProt: C0ZTP2
Position
complement(6056888..6057766)
Genome map
AA seq 292 aa AA seqDB search
MMTDFATLKYETSGGKAYITLNRPDRLNAIDDRMPSDIRNAVAAANDDDDVRVIILQGAG
KAFCAGYDLKKFAEGDLDGKWNQGPVWDPIKDFRGMKQNTDGFTLWRSLKPTICKVQGHA
VAGGSDIALSCDMLIMADDARIGYPPARVWGCPTTAMWVYRLGAQRAKRMLLTGDTIDGV
TAADWGLALESVPPDELDAAVEALADRIAGVPLNQLAMQKMMINQAYDNMGLQGTQVLAT
LFDGITRHSPEGRWFKDFAERDGFHAAVQYRDSGRKIPDGGGPLPESDTPSR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagattttgcgaccctgaaatacgagacctctggtggtaaggcgtacatcacc
ctgaaccgccccgatcggctcaacgcaatcgacgatcggatgccgtcggacatccgaaat
gcagttgcggcggccaatgacgacgacgacgttcgcgtgatcatcttgcaaggcgcaggc
aaggcgttttgcgccgggtacgacctcaagaagttcgccgaaggagatctcgacggaaag
tggaatcaaggcccggtgtgggaccccatcaaggactttcggggcatgaagcagaacacc
gacggcttcaccctctggcgatcgctcaagccgaccatctgcaaagttcagggtcatgca
gtcgcaggcggaagcgatattgcgctgtcttgcgacatgctgatcatggctgacgacgcc
cgcatcggatacccgcctgctcgcgtctggggttgcccgaccacagctatgtgggtgtac
cgcctcggggcgcaacgcgccaagcgaatgttgttgacgggagacaccattgacggtgtc
accgccgccgattggggattggcgctcgaatcggtgccgcccgacgaactggacgctgcg
gtggaggcgttggcggatcgcatcgccggtgtcccgctcaatcaattggcaatgcagaag
atgatgatcaatcaggcgtacgacaacatggggttgcagggtacccaggtgctggcaacc
ctgttcgacggaatcacgcgccactcgccggaagggcgctggttcaaggattttgccgaa
cgcgacggatttcacgccgcggtgcagtaccgcgattccggccgcaagattccagacgga
ggcgggccgctccccgaatccgacaccccttcacgatag

DBGET integrated database retrieval system