KEGG   Rhizobium etli CFN 42: RHE_CH00037Help
Entry
RHE_CH00037       CDS       T00317                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase protein
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00010  Glycolysis / Gluconeogenesis
ret00020  Citrate cycle (TCA cycle)
ret00620  Pyruvate metabolism
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_CH00037 (pckA)
   00020 Citrate cycle (TCA cycle)
    RHE_CH00037 (pckA)
   00620 Pyruvate metabolism
    RHE_CH00037 (pckA)
Enzymes [BR:ret01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     RHE_CH00037 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_25
Motif
Other DBs
NCBI-ProteinID: ABC88870
RhizoBase: RHE_CH00037
UniProt: Q2KE66
Position
39928..41538
Genome map
AA seq 536 aa AA seqDB search
MEKFGVHNPATELATVGLGGAASVRYNFSAAALYEEAIRRGEAELTAQGALRALTGQHTG
RSPRDKFVVRDANTDGQIWWDNNKPLSPEHFALLRDDMLAHAAGKDLFAQDLVGGAEEGH
ALPTRVITELAWHSLFIRNLLIRPEAAALPTFVPKLTIIDLPSFKADPARHGCRSETVIA
CDLTNGLVLIGGTSYAGEMKKSVFTVLNYLLPAKGVMPMHCSANVGPDGDAAVFFGLSGT
GKTTLSADPARTLIGDDEHGWSENGIFNFEGGCYAKTIRLSAEAEPEIYATTQRFGTVLE
NVVLNERREPDFDDGSLTENTRCAYPMHFIPNASETGRAGHPKTIIMLTADAFGVMPPIA
RLTPDQAMYHFLSGYTAKVAGTEKGVVEPEATFSTCFGAPFMPRHPAEYGNLLKELISRH
GVECWLVNTGWTGGAYGTGKRMPIKATRGLLAAALSGKLGQLQFRTDTNFGFAVPVSVDG
VDGSILDPRSTWADKAAYDAQAEKLVSMFIANFAKFEDHVDGGVRDAAPGVKAAAE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttcggagttcataacccggcaacggagcttgcaacggttggattgggcggc
gcagccagcgtccgctataacttttccgccgcagcgctctatgaagaagcgatccgccgg
ggtgaagccgaactgaccgcccagggcgcgcttcgggccctcaccggtcagcatacgggc
cgttcgccgcgcgacaaattcgtcgttcgcgatgccaataccgatggccagatctggtgg
gacaacaacaagccgctctcgccggaacattttgcgctgctgcgcgacgacatgctggcg
catgcagcgggcaaggatctgttcgcccaggatcttgtcggcggtgccgaggaaggtcat
gccctgccgacgcgcgtcatcaccgaattggcctggcattcgctgttcatccgcaatctg
ctgatccgccccgaggcggcggcgctgccgaccttcgtgccgaagctgacgatcatcgat
ctgccgagcttcaaggccgatccggcgcgccacggctgccgttcggaaacggtgatcgcc
tgcgatctcaccaacggtctcgttctcatcggcggcacctcctatgccggcgaaatgaag
aagtcagtcttcaccgtgctcaactacctgctgccggccaagggtgtcatgccgatgcac
tgctcggccaatgtcggtccggacggagacgcggcggtcttcttcggtctttccggcacc
ggcaagacgacgctttcggccgatccggcccgcacgctgatcggggacgatgaacatggc
tggagcgagaacggcatcttcaacttcgaaggcggctgctacgccaagaccatccgcctc
tcggccgaggccgagccggaaatctacgcaacgacgcagcgcttcggcacagtgctcgaa
aacgtcgtcctcaacgaacggcgtgagcccgatttcgacgacggttcgctgactgaaaat
acccgttgcgcctacccgatgcatttcatcccgaatgcctcggaaaccggccgggccggg
catccgaagacgatcatcatgctgaccgccgacgccttcggcgtcatgccgccgatcgcg
cgcctgacgcccgatcaggcgatgtatcacttcctctccggctacaccgccaaggtggcc
ggcaccgaaaagggtgtcgtcgagccggaagcgaccttctccacctgcttcggcgcgccc
ttcatgccgcgtcatccggccgaatacggcaatctgctcaaggagctgatcagccgccac
ggcgtcgagtgctggctcgttaacaccggctggaccggcggcgcctacggcaccggcaag
cgcatgccgatcaaggcgacgcgcggccttctcgctgccgccctcagcggcaaactcggc
cagctccaattccgcacggatacgaatttcggctttgccgtgccggtttccgtcgatggc
gtcgacggcagcattctcgatccccgctcgacctgggctgacaaggctgcctacgacgcg
caggccgaaaagctggtctcgatgttcatcgccaacttcgccaagttcgaagatcacgtt
gatggcggcgtccgcgatgcggccccgggcgtaaaggccgccgccgaataa

DBGET integrated database retrieval system