KEGG   Rhizobium etli CFN 42: RHE_CH00138Help
Entry
RHE_CH00138       CDS       T00317                                 

Definition
(GenBank) probable D-2-hydroxyacid dehydrogenase protein
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00630  Glyoxylate and dicarboxylate metabolism
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RHE_CH00138
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     RHE_CH00138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 GFO_IDH_MocA IlvN Pyr_redox_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABC88963
RhizoBase: RHE_CH00138
UniProt: Q2KDX3
Position
147023..148024
Genome map
AA seq 333 aa AA seqDB search
MTAKKKPKVYITRKLPDAVETRMRELFDAELNIDDAPRSVPELIAAVRTADVLVPTVTDR
IDAALIDEAGPQMKLIASFSNGTDHIDVEAAARKGITVTNTPNVLTEDTADMTMALILAV
PRRLGEGARILTDKPGEWAGWSPTWMLGRRIHGKRIGIVGMGRIGTAVARRAKAFGLSIH
YHNRKRVNPAVEDELEATYWESLDQMLARVDIVSINCPSTPATFHLISARRLALLQPTAY
LVNTARGDVVDETALIKCLREGRIAGAGLDVFENEPAVNPKLVKLANEGKVVLLPHMSSA
TIEGRIDMGDKVIINIRTFIDGHRPPNRVLPGR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgaagaaaaaaccgaaggtctatattacccgcaagttgccggatgccgtcgaa
acccgaatgcgggagctcttcgatgccgagctgaacatcgatgacgcgccgcgctccgtt
cccgagcttatcgccgctgtgcggaccgccgacgtgctggtgccgacggtcaccgatcgc
atcgatgcggcgctgatcgatgaggcgggaccgcagatgaagctgattgccagcttctcc
aacggcaccgaccacatcgacgtcgaggcggcggcgcgcaagggcatcaccgtcaccaat
acgccgaacgtcctgaccgaggacactgccgatatgacaatggcgctgattctcgcggtc
ccgaggcggctcggcgaaggggcgcggatcctgaccgacaagccgggcgagtgggccggc
tggtctccgacctggatgctcggccggcgcattcacggcaagcggatcggcatcgtcggc
atggggcgaatcggcacggcggtggcccgccgcgccaaggcttttggtctttcgattcac
taccacaaccgcaagcgcgtcaatccggcggtcgaggacgagttggaggcaacctattgg
gaaagcctcgaccagatgctggcccgcgtcgacatcgtctcgatcaactgcccctcgaca
ccggcaacctttcacctgatttcggcgcgccgcctggcactgctgcagccgacggcctat
ctcgtcaatacggcgcgcggcgacgtcgtcgacgaaaccgcgctgatcaagtgcctgaga
gagggcaggatcgccggcgccggcctcgatgttttcgagaacgagcctgccgtcaatccg
aagctcgtcaaactcgccaacgagggcaaggtcgtgctgctgccgcatatgagctcggcg
acgatcgaaggccgcatcgacatgggcgacaaggtcatcatcaatatccgcacgttcatc
gacggccacagaccgccgaatcgggtgctgcctggccgttga

DBGET integrated database retrieval system