KEGG   Rhizobium etli CFN 42: RHE_CH00559Help
Entry
RHE_CH00559       CDS       T00317                                 

Gene name
fadB2
Definition
(GenBank) enoyl-CoA hydratase protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00071  Fatty acid degradation
ret00280  Valine, leucine and isoleucine degradation
ret00281  Geraniol degradation
ret00310  Lysine degradation
ret00362  Benzoate degradation
ret00380  Tryptophan metabolism
ret00410  beta-Alanine metabolism
ret00640  Propanoate metabolism
ret00650  Butanoate metabolism
ret00903  Limonene and pinene degradation
ret00930  Caprolactam degradation
ret01040  Biosynthesis of unsaturated fatty acids
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01200  Carbon metabolism
ret01212  Fatty acid metabolism
Module
ret_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHE_CH00559 (fadB2)
   00650 Butanoate metabolism
    RHE_CH00559 (fadB2)
  Lipid metabolism
   00071 Fatty acid degradation
    RHE_CH00559 (fadB2)
   01040 Biosynthesis of unsaturated fatty acids
    RHE_CH00559 (fadB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHE_CH00559 (fadB2)
   00310 Lysine degradation
    RHE_CH00559 (fadB2)
   00380 Tryptophan metabolism
    RHE_CH00559 (fadB2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHE_CH00559 (fadB2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHE_CH00559 (fadB2)
   00281 Geraniol degradation
    RHE_CH00559 (fadB2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHE_CH00559 (fadB2)
   00930 Caprolactam degradation
    RHE_CH00559 (fadB2)
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RHE_CH00559 (fadB2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RHE_CH00559 (fadB2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RHE_CH00559 (fadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 FAD_binding_3 NAD_binding_8 UDPG_MGDP_dh_N NAD_binding_7 2-Hacid_dh_C Pyr_redox_2 Pyr_redox F420_oxidored ApbA GIDA
Motif
Other DBs
NCBI-ProteinID: ABC89377
RhizoBase: RHE_CH00559
UniProt: Q2KCQ9
Position
579893..582109
Genome map
AA seq 738 aa AA seqDB search
MSTYTNFTLETDADGIALVTWDMPGKSMNVFTAEVMEELNAIIDATTADASVKGVVFTSG
KSSFSGGADLSMIKSMFSSYQEEKAKSPEKAVQTLFGLVGRMSGLFRKLETSGKPWVSAI
NGTCMGGAFELSLACHGRVASNAKSVKIALPEVKVGIFPGAGGTQRVPRLANAQDALQMM
TTGQSLSGSRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVAPWDEKGFKLPGGGIWTPA
SAQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGLKIEQRYFTEVLQTREAFS
MIRSLFISMQELGKGARRPAGIPKTELKHVGVVGAGFMGASIAYVTAAAGISVTLIDRDM
EAAAKGKAVSEGLVKDAIGKGRLTQDEAAALLSRITPSGDYADLANVGLVIEAVFEDREV
KKAVIDAVEAVLPEGAIFASNTSTLPITGLARNSKRPADFIGIHFFSPVEKMMLTEVILG
TETGDRALAVALDYVAAIKKTPIVVNDTRGFFVNRCVLRYMSESYDMLIEGVPPAMIENA
AKMAGMPVGPLALNDEVAIDLSLKILKAAVADLGEKAIDPRHMELISRMVEKEGRFGRKN
SKGFYDYPPKPAKKSLWPDLKSFYPQKKAEEVDVNVLKQRFLVTIALEAARTVEEGIVTD
PREADVGSILGFGFAPYTGGALSYIDGMGAKAFVDLAERLAETYGDHFKPTPLLRDLAAK
GETFYGRFDPYAGTKAAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctacaccaatttcacgctcgaaaccgacgctgatggcatcgctctcgtcacc
tgggacatgcccggcaaatcgatgaacgttttcaccgccgaggtgatggaagagctcaat
gcgatcatcgacgccaccaccgctgacgccagcgtcaagggtgtcgtcttcacatcgggc
aaatcctccttctccggcggcgccgatctttcgatgatcaagtcgatgttcagctcctat
caggaggagaaggccaagagcccggaaaaggcggtacagacgctctttggtctggttggc
cgaatgagcggcctgttccgcaagctcgaaacctcgggcaagccctgggtttccgccatc
aatggcacctgcatgggcggcgcattcgaactgtcgctcgcctgccacggccgcgtcgcc
tccaatgccaagagcgtcaagatcgcgctgcccgaggtcaaggtcggcatcttccccggc
gccggcggcacccagcgtgtgccgcggctggcgaacgcccaggacgcgctgcagatgatg
acgacgggtcagtcgctgagcggctcgcgcgccaaggcgatgaacctcgtgcatcaggtg
gtcgagccggatcagctgatcccggccgccaagcagatgatcaaggacgggctgaagccg
gtggccccctgggacgagaagggcttcaagctgccgggcggcggcatctggacgccggcc
tcggcccaactctggccagccgcaccggcaatcctgcgccgcgaaacctcgggcaattat
ccggccgcgctcgccatcctgaaatgcgtctatgaaggcctgcaggtgccgttcgacacg
ggtctcaagatcgagcagcgttatttcaccgaggtgctgcagacccgcgaagccttctcg
atgatccgttcgctgttcatctccatgcaggagctcggcaagggcgcccgccgccccgcc
ggcattccgaagacggagctcaagcatgtcggcgtcgtcggcgccggcttcatgggcgcc
tcgatcgcctatgtcacggcagctgccggcatttcggtgacgttgatcgaccgtgacatg
gaagcggctgccaagggcaaggccgtttccgaaggcctcgtcaaggatgcaatcggtaag
ggacgccttactcaagatgaggcggcagcccttctctcccgcatcacgccatcgggcgat
tatgccgatctcgccaatgtcggcctcgttatcgaggccgtgttcgaggatcgcgaggta
aagaaggcggttatcgacgctgttgaagcggtgctgccggaaggcgcgatcttcgcctcc
aacacgtcgacgctgccgatcacggggctggcaaggaattccaaacgcccggccgatttc
atcggcatccacttcttctcgcccgtcgaaaagatgatgctgaccgaggtcatcctcggc
acggagaccggcgacagggcgttggcggtcgctctcgactatgtcgcggcgatcaagaag
acgccgatcgtggtcaacgacacgcgcggtttcttcgtcaatcgctgcgtgctgcgctac
atgtcggaaagctacgacatgctgatcgaaggcgtgccgcctgccatgatcgaaaatgct
gccaagatggccggcatgccggtcggtccgctggcgctcaacgacgaggtcgccatcgac
ctctcgcttaagatcctcaaagccgccgtcgccgatctcggcgagaaggccatcgacccc
aggcatatggagcttatctcccgcatggtggagaaggagggccgcttcggccgcaagaat
tccaaaggcttctatgactaccccccgaaaccggccaagaaatccctctggcccgatctc
aagagcttctatccgcagaagaaggcggaggaggtcgacgttaacgtgctgaagcagcgt
ttcctcgtcaccatcgcgctcgaagccgcccgcaccgtggaagaaggcatcgtcaccgat
ccgcgcgaagccgacgtcggctcgatcctcggcttcggcttcgcgccctataccgggggt
gcgctgagctatatcgatggcatgggcgcgaaggctttcgtggatctggctgaaaggttg
gcggaaacttacggagatcacttcaagccgacgccgctgctgagggatctggctgccaag
ggcgagacgttctacgggcggttcgatccctatgcggggacgaaggccgcggcgtaa

DBGET integrated database retrieval system