KEGG   Rhizobium etli CFN 42: RHE_CH00567
Entry
RHE_CH00567       CDS       T00317                                 

Gene name
mscL
Definition
(GenBank) large-conductance mechanosensitive channel transmembrane protein
  KO
K03282  large conductance mechanosensitive channel
Organism
ret  Rhizobium etli CFN 42
Brite
KEGG Orthology (KO) [BR:ret00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ret02000]
    RHE_CH00567 (mscL)
Transporters [BR:ret02000]
 Other transporters
  Pores ion channels [TC:1]
   RHE_CH00567 (mscL)
SSDB
Motif
Pfam: MscL DUF3810
Other DBs
NCBI-ProteinID: ABC89385
RhizoBase: RHE_CH00567
UniProt: Q2KCQ1
Position
589951..590388
AA seq 145 aa
MLNEFKAFIARGNVMDLAVGVIIGGAFGGIVKSLVDDLIMPIVGAIFGGFDFSNYFLPLS
SAVNAPTLAAARAQGAVFAYGSFLTVLINFLILAWIIFLMVKAVNYLRQQVERQEKQEPE
QLPPPPADVQLLTEIRDLLAKRPAV
NT seq 438 nt   +upstreamnt  +downstreamnt
atgctcaatgagttcaaggcctttatcgcccgcggcaatgtcatggatcttgcagtcggc
gtcatcatcggcggtgccttcggtggcatcgtcaaatcgctggtcgacgaccttatcatg
ccgatcgtcggcgccattttcggcggcttcgatttttccaattatttcctgccgctctcg
tcggccgtcaacgcgcccacacttgccgccgcccgcgcccaaggggcggtcttcgcctat
ggcagcttcctcactgtcctcatcaatttcttgatccttgcctggattatcttcctgatg
gtcaaggcggtgaactatctgcgccagcaggtcgagcgtcaggaaaagcaggagccggaa
caattgccgccgccgccggccgacgtccagctgctgaccgagatccgcgatctgctggcc
aaacgccccgccgtctga

DBGET integrated database retrieval system