KEGG   Rhizobium etli CFN 42: RHE_CH00631Help
Entry
RHE_CH00631       CDS       T00317                                 

Gene name
secD1
Definition
(GenBank) protein-export translocase protein
  KO
K12257  SecD/SecF fusion protein
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02024  Quorum sensing
ret03060  Protein export
ret03070  Bacterial secretion system
Module
ret_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:ret00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    RHE_CH00631 (secD1)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    RHE_CH00631 (secD1)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RHE_CH00631 (secD1)
Secretion system [BR:ret02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   RHE_CH00631 (secD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF Sec_GG ACR_tran MMPL SecD-TM1 Sterol-sensing
Motif
Other DBs
NCBI-ProteinID: ABC89447
RhizoBase: RHE_CH00631
UniProt: Q2KCI9
Position
complement(651050..653599)
Genome map
AA seq 849 aa AA seqDB search
MRTSPWLVLTYTVIIVVGILIALPNVLSQSVLQRIPSWLPHEQVSLGLDLRGGSHLVLEV
DEADLTKERLQSLLQDARRVLREKGIQPKAVVRNQNQIVVTLADASQSDAAVTDLKTLAN
PIGTGLSAGQADLTVTANGATITVAFSPAGISANVDNAVQQSLEVIRQRVDQVGVSEPTI
QRIGANRVLVQLPGAQDPSHLRELLGSTAKMSFHMLAPNNQPGPGVTMMQDDEGRSYPVL
DRVEISGDRLSDARVGFDPNTHEPIVSFRFDSAGATRFAEITRQNVGNPFAIVLDDKVLS
APVIREPITGGSGQISGNFSADSATTLAAMLRAGALPAKLTVIEERTVGADLGADAIKMG
IYSGIVGFILVAAFIFVLYGTWGILANVALLIHTILTFSALTLVGATLTLPGIAGVVLGI
GLAVDANVLINERIREETRKGKGAFAAIDTGFNRAYSTIIDGNMTALIAAAILFWFGSGP
VRGFAVTMALGLIISMFTSVAFVRVAMIEITRRRKFKVLNIRPLIPFSPYDKHIQFMKAR
FFGVTVSALLSIASVVLFIHPGLNYGVDFRGGIQMSVKTKEAADLAKFREGLDSLGLGEI
TLQTFGDNKSILVRAQRQEGGEEAQTAAVTKLKAEVAKIDPSATVEGTDVIGPKVSGELA
SAGILSVVIASFAMLIYIWVRFEWPFAVGAIVTLVLDVTKAIGFFAITGLDFNLTAIAAI
LTLVGYSVNDKVVVYDRMRENMRLYKSMPLREIIDKSINETLARSLYTNATAFLALVPMA
IWGGSAVSSFAIPMVFGILVAGASSIFIAAPILLFLGDWRRRHAKAVAATDAAAEIIPPD
ESRSRKSAS
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacttcaccatggctggtgctcacctatacggtgatcatcgtagtgggcatcttg
atcgccctgccgaacgtcctgtcgcaatccgtcctccagcgcatcccttcatggctgccg
catgagcaggtgtcgctcggccttgaccttcgcggcggctcgcatctcgttctggaagtc
gacgaggcggatctgaccaaggagcggctgcagtcgctgcttcaggacgcccgccgcgta
ctgcgtgaaaagggcatccagccgaaggccgtcgtacgcaatcagaaccagatcgtcgtg
acgcttgcagacgcctcgcagagcgatgcggccgttaccgacctcaagacgctcgccaac
ccgatcggcaccggcctcagcgccggccaggccgacctgacggtcaccgcgaatggagcg
accatcaccgtagccttctcgccggccggcatctccgccaatgtcgacaacgccgtccag
cagagccttgaagtcatccgccagcgcgtcgaccaggtcggcgtctccgagccgaccatt
caacgtatcggcgctaaccgcgtgctcgtccagcttcccggcgcacaggatccgtcgcac
ctgcgcgaacttctgggttccacggcaaagatgtcgttccacatgctggcgccgaacaac
cagcccggccctggcgtcaccatgatgcaggatgacgaaggccgatcctatccggtgctc
gaccgcgtcgaaatctccggcgaccgcctttcggatgcgcgcgtcggcttcgaccccaac
acgcacgagccgatcgtcagcttccgcttcgacagcgccggcgctacccgctttgccgag
atcacccgccagaatgtcggcaatccctttgccatcgtcctcgacgacaaggtgctgagc
gctcccgtcatccgcgagccaatcaccggcggttccggccagatctccggtaacttctcg
gccgacagcgccaccacgcttgccgccatgctgcgcgccggcgccctgcccgccaagctg
accgtcatcgaggagcgcaccgtcggcgccgacctcggcgccgacgcgatcaagatgggc
atctattccggtatcgtcggcttcatcctcgtcgcggccttcatcttcgtgctctacggc
acctggggcatcctggcgaatgtggcgctgctgatccacaccatcctgaccttctcggcg
ctgacgctggtcggcgcaacgctgacgctgccgggtattgccggcgtcgttctaggcatt
ggcctcgcggtcgatgcgaacgtcctgatcaatgaacgtattcgtgaagagacccgcaag
ggcaagggcgcctttgccgccatcgatacgggtttcaatcgagcctattcgactattatc
gacggcaacatgacggccctgatcgctgcggccatcctgttctggttcggctccgggccg
gttcgcggctttgccgtgaccatggcgctcggcctgatcatctcgatgttcacttcggtc
gccttcgttcgcgtggcgatgatcgagattactcgccgccgcaagttcaaggtgctgaac
atccggccgttgatccccttcagcccctatgacaagcacatccagttcatgaaggcgcgc
ttcttcggcgtcaccgtttcggcgctgctttcgatcgcctccgtcgtgctctttatccat
cccggcctgaattacggcgtcgatttccgcggcggcatccagatgtcggtcaagacgaaa
gaggcggccgatctggcgaagttccgtgagggtctcgatagtctcggcctcggcgaaatt
acgctgcagaccttcggcgacaacaaaagcattctcgttcgggcgcagcggcaggaaggc
ggcgaagaggcgcagacagctgcggtgaccaagctgaaggccgaagtcgccaagatcgat
ccgagcgccaccgtcgaagggaccgacgtcatcggtccgaaggtcagcggcgagcttgcc
tcggccggcatcctgtcggtcgtgatcgccagcttcgcgatgctcatctatatctgggta
cggttcgaatggccctttgccgtcggcgccatcgttacgctggtgctcgacgtcaccaag
gcgatcggcttcttcgcaatcaccggcctcgacttcaacctgacggccatcgccgccatc
ctaacgctcgtcggctattcggtgaacgacaaggtcgtcgtctacgaccgcatgcgcgaa
aacatgcggctctacaagtcgatgccgctgcgcgagatcatcgacaagtcgatcaacgag
accctggcgcgaagcctttataccaatgccacggccttcctcgccctggtgccgatggcg
atctggggcggcagcgccgtctcgagctttgcgatcccgatggtcttcggcattctggtg
gccggcgcctcgtcgatcttcatcgccgcaccgatcctgctcttcctcggcgactggcgc
cgccgccacgccaaggcggtagcggcaaccgacgcggcggccgaaatcatcccgcctgac
gagagccgctcgcgcaagtcggcgagctga

DBGET integrated database retrieval system