KEGG   Rhizobium etli CFN 42: RHE_CH00632Help
Entry
RHE_CH00632       CDS       T00317                                 

Definition
(GenBank) hypothetical protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABC89448
RhizoBase: RHE_CH00632
UniProt: Q2KCI8
Position
complement(653684..654076)
Genome map
AA seq 130 aa AA seqDB search
MEEMGLDQHRLTSRIAASLLFAILAYIGLLFGGNLVISPAAALNNTLSSSGRDPQPQQLT
ARDAVRGVLAADRKLAPKQAAYDAGSPALAAPPVVDFAGRNMATAVPAPEAPLPAAVFRI
YQPRAPPTVA
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggaggagatggggctggatcagcaccgtctgacgagccgtatcgccgcttcccttctc
ttcgccatcctcgcctatattggcctgcttttcggcggcaatctggtcatttcgccagcg
gcggctctcaacaataccctttcctcttccggccgcgatccacagccgcagcaactgacc
gcgcgcgatgcggtgcgcggcgtgcttgccgccgaccgcaagcttgcgcccaagcaggca
gcttatgatgccggatcgcctgcccttgccgctccgccagtcgttgatttcgccggccgg
aacatggccactgctgttccggcacccgaggcgccgcttcctgccgccgttttcaggatt
tatcagccgcgcgcgccgccgacggtcgcctaa

DBGET integrated database retrieval system