KEGG   Rhizobium etli CFN 42: RHE_CH00633Help
Entry
RHE_CH00633       CDS       T00317                                 

Definition
(GenBank) putative potassium-efflux system protein
  KO
K03455  monovalent cation:H+ antiporter-2, CPA2 family
Organism
ret  Rhizobium etli CFN 42
Brite
KEGG Orthology (KO) [BR:ret00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RHE_CH00633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABC89449
RhizoBase: RHE_CH00633
UniProt: Q2KCI7
Position
complement(654122..655939)
Genome map
AA seq 605 aa AA seqDB search
MPHDTPLISTIVGGLVLAFIFGALAHRMRMPPLVGYLIAGVLVGPHTPGYVADQSLAPEL
AEIGVILLMFGVGLHFSLKDLLSVRGIALPGAIVQIGFATLLGWGLGAFMGWPTGGSLVF
GLALSVASTVVLLKALQERRLVETERGRIAVGWLIVEDLAMVLALVLIPAAASIGGGHGP
VEPLSAGLNSLLGLDLGIGGMIAMTLVKVALFVALMLVFGRKLVPWTMHRIAHTGSRELF
RLGVLAIALGVAFGAAKLFGVSLALGAFFAGMVLAESELSHRAAQESLPLRDAFAVLFFV
SVGMLFDPNILLDRPLPILATVFIIVIGKSVAAFLIVLAFKKSPGTALTISASLGQIGEF
SFILAALGVELGLLPEEGRNLILAGAIISIILNPLLFFLCDRMRPVLESARREETAADPA
SAADTGAAQEQVPPGDDEVHPSPLNGHAILIGYGRVGRIVGQNLKSSGTAFLVIEDSDKR
IGELKAQGIEAFMGNAVARETLDLANLSAARSLAIAIPNAFEACRIAEQARSVNPSILIV
ARAHSDAEVDELKQYGADTVIMGEREIALGMVDRLAQVHHESVSYEDRQEPATIIPTGTA
PPERE
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgccgcacgatacgcccttgatttcgacgatcgtcggcggcctcgtgctggctttcatc
ttcggcgcgcttgctcatcgaatgcgcatgccgccgctcgtcggctacctgatcgccggg
gtgctggtggggccgcatacgcccggttacgtggcggatcagagccttgcgccggagctt
gccgaaatcggcgtcatcctgctgatgttcggcgttgggctgcatttctcgctcaaagac
ctgctatcggtccgcggcatcgcgctgcctggcgcgatcgtgcagatcggttttgcgact
ttgctcggctggggcctcggcgccttcatgggctggccgaccggcggcagcctggtcttt
gggctggcgctttcggtcgcctctaccgtcgtgctgctgaaggcgctacaggagcgccgg
ctggtggagacggagcgcggccggattgccgtcggctggctgatcgtcgaagacctcgcc
atggtgctggcgctggtgctgatcccggcggcagccagcatcggcggcggccatggccct
gtcgagccgctgtcggcgggtctgaacagtctgctcggcctcgatctcggcatcggcggc
atgatcgccatgacgctggtcaaggtggcgctgttcgtggcgctgatgctggtcttcggc
cgcaagctcgttccctggaccatgcaccgcatcgcccataccggctcgcgcgagctcttc
cgacttggtgtgctcgccatcgcgcttggcgtcgccttcggcgcggccaagctgttcggc
gtgtcgctggcgctcggcgccttcttcgccggcatggtgctggccgaaagtgagctcagc
catcgcgccgcccaggaaagcctgccgctgcgcgacgcctttgccgtgctcttcttcgtc
tcggtcggcatgctgttcgacccgaacatcctgctcgacaggccgctgcccattctcgcc
accgtcttcatcatcgtcatcggcaaatcggtggccgcctttctgatcgtgctcgccttc
aagaagtcgcccggtacggcgctgacgatttcggcaagcctcggtcagatcggcgaattc
tccttcatcctcgccgctctcggcgtcgaactcgggctgttgccggaggagggccgcaac
ctgatccttgccggcgccatcatctcgatcatcctcaatccgctgctgttcttcctctgc
gaccggatgcggcctgttctcgaaagtgcaaggcgcgaggaaacggcagccgacccggct
tcggccgcggatacgggagccgcgcaggagcaggtgccgcctggggacgacgaggtgcat
ccgagcccacttaacggtcacgccatcctcatcggctacggccgggtcggcaggatcgtc
gggcagaatctcaaatcgtcaggcacggccttcctcgtcatcgaggattccgacaagcgc
atcggcgaattgaaagcgcaagggatcgaagccttcatgggcaatgcggtggcgcgggag
acgctcgatctcgccaatctttcggctgcgcgcagccttgccatcgccatccccaacgcc
ttcgaggcctgccgcatcgccgagcaggcgcgcagcgtcaatccctctatcctcatcgtc
gcccgcgcccattccgacgccgaggtcgacgagctgaaacaatacggcgccgacaccgtc
atcatgggcgaacgggaaatcgcgcttggcatggttgaccggctggctcaagtgcatcat
gagagtgtttcctatgaagacaggcaggagcctgctacaattatcccgacgggcactgct
ccgccggagcgagaatga

DBGET integrated database retrieval system