KEGG   Rhizobium etli CFN 42: RHE_CH00638Help
Entry
RHE_CH00638       CDS       T00317                                 

Gene name
cheY1
Definition
(GenBank) chemotaxis two-component response regulator protein
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02020  Two-component system
ret02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RHE_CH00638 (cheY1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RHE_CH00638 (cheY1)
Two-component system [BR:ret02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RHE_CH00638 (cheY1)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RHE_CH00638 (cheY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg FleQ
Motif
Other DBs
NCBI-ProteinID: ABC89454
RhizoBase: RHE_CH00638
UniProt: Q2KCI2
Position
660341..660706
Genome map
AA seq 121 aa AA seqDB search
MKKKVLTVDDSRTIRNMLLVTLNNAGFDTIQAEDGVEGLEVLEESNPDVIVTDINMPRLD
GFGFIEGVRRNEKYRAIPILVLTTESDAEKKNRARQAGATGWIVKPFDPAKLIDAIERVT
A
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaagtgcttaccgtggatgattcccgcaccatccgaaacatgctgctcgtg
acgctgaataatgccggtttcgacacgattcaggcggaagacggcgtcgagggcctcgag
gttctcgaagagtccaatcctgacgtgatcgtgaccgacatcaacatgccgcgcctcgac
gggttcggcttcatcgaaggtgtgcgccgcaacgagaagtatcgggcgatcccgatcctg
gtcctgacgaccgagagcgacgcggaaaagaagaaccgtgcccgccaggccggcgccacg
ggatggatcgtcaagcctttcgatccggccaagctgatcgatgcaattgagcgcgtaacc
gcttaa

DBGET integrated database retrieval system