KEGG   Rhizobium etli CFN 42: RHE_CH00639Help
Entry
RHE_CH00639       CDS       T00317                                 

Gene name
cheA
Definition
(GenBank) chemotaxis two-component sensor histidine kinase protein
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02020  Two-component system
ret02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RHE_CH00639 (cheA)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RHE_CH00639 (cheA)
Enzymes [BR:ret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     RHE_CH00639 (cheA)
Protein kinases [BR:ret01001]
 Histidine kinases
  CheA family [OT]
   RHE_CH00639 (cheA)
Two-component system [BR:ret02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RHE_CH00639 (cheA)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RHE_CH00639 (cheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW Hpt HATPase_c H-kinase_dim K-box CCDC53 HATPase_c_3 PLC-beta_C HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: ABC89455
RhizoBase: RHE_CH00639
UniProt: Q2KCI1
Position
660724..663006
Genome map
AA seq 760 aa AA seqDB search
MDMNEIKEIFFQECEEQLAELESGLLKMNDGDRDPETVNAVFRAVHSIKGGAGAFGLDDL
VAFAHVFETTLDCVRSNKLEPTQDVLKVMLKSADVLADLTNAARDGGSVDESRSRGLVKE
LEALANGELPSPSAEPPAPKAAAKAAPAAPAPAAKPTDDSGFQPIPFSFDDFGDEDGAET
GLPAYEITFKPRHELYSKGNDATLLLRDLSRLGEMTIYCNMDELPGLEELDPEAAYFFWN
ITIKTDKGEDAIRTVFEFAEWDCDLTVKPVEEASAGVTGNEELPMVPVPFDLSILDETDA
AEAVSAARSEDTAAAVAAAETASNVTQMAAAAARVEKKESAAAAAAAANAAAQNNAAGAG
QTIRVDLDRVDRLINLVGELVINQAMLSQSVIENDTTGTSSINMGLEELQQLTREIQDSV
MAIRAQPVKPVFQRMSRIVREIADMTGKSIRLITEGENTEVDKTVIDKLAEPLTHMIRNA
VDHGIETPEKRAAAGKNTEGTVRLTAKHRSGRILIELADDGAGINREKVRQKAIDNDLIP
ADANLSDEEIDNLIFLPGFSTADKISDISGRGVGMDVVKRSIQALGGRINITSKPGHGSV
FTMSLPLTLAVLDGMVVTVAGQTLVVPLTAIVETLQPEAAAIHSFGANHRLISIRNSFCP
LVDVGRILNFRATQANPVEGVALLVESEGGGQRALMVDAIQGQRQVVIKSLEANYTHVPG
IAAATILGDGRVALILDVDAVVGASRGHSLKAEMSLAAVG
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggatatgaacgaaatcaaagagatctttttccaggagtgcgaggaacagctcgccgag
ctggaatccggtcttctgaaaatgaacgatggcgatcgcgatccggaaaccgtcaatgcg
gtgttccgtgccgtgcattcgatcaaggggggcgccggcgccttcggccttgatgatctc
gtagccttcgcccatgttttcgagaccactctcgattgcgttcgctccaacaagctcgag
ccgacccaggatgtcctgaaggtgatgctgaagtcggccgacgtgctcgccgacctgacc
aatgccgcgcgcgacggcggcagtgtcgatgaaagccgcagccgtggtctcgtcaaggag
ctcgaggcgctggccaatggcgagctgccgtctccttcggccgaaccgcctgcgcccaag
gccgccgcaaaggcggctccggccgctcctgcgccggccgccaagccgactgacgacagc
ggcttccagccgatccccttttccttcgacgatttcggcgatgaggacggcgcagagacc
ggtctgccggcctacgagatcaccttcaagccgcgccacgaactctattcgaagggtaat
gacgccaccctgctgctacgcgacctttcgcgcctcggcgaaatgacgatctattgcaat
atggatgagctgcccggtctcgaggagctcgatccggaggctgcctatttcttctggaac
atcacgatcaagaccgacaagggtgaagacgccatccgaaccgtcttcgaattcgctgaa
tgggattgcgacctcacggtaaagccagtcgaggaagcaagcgccggcgtgaccggcaat
gaggaactgccgatggtgccggttcccttcgacctgtcgatcctggacgaaaccgacgca
gcggaagccgtttccgcggcacggtccgaagacacggccgctgccgttgctgccgccgag
accgcttccaatgtcacgcagatggcggccgccgccgctcgcgtcgaaaagaaggaatcg
gccgccgccgcagccgccgcggccaatgccgccgcccagaacaacgccgccggcgccggc
cagacgatccgcgtcgatctcgatcgcgtcgaccgtctcatcaacctcgttggcgaattg
gtcatcaaccaggcgatgctgtcgcagagcgtcatcgagaacgacacaaccggcacgtct
tcgatcaacatgggtctcgaggagctgcagcagctcacccgcgagatccaggattcggtc
atggcgatccgcgcccagccggtcaagccggtcttccagcgcatgtcgcgtatcgtccgc
gaaatcgccgacatgactggcaagtcgatccgcctcattaccgaaggtgagaataccgaa
gtcgacaagacggtcatcgacaagctggccgagccgctgacccacatgatccgcaatgcc
gtcgaccacggcatcgaaacgccggaaaagcgggctgccgccggcaagaacaccgaaggc
acggtgcgcctcaccgccaagcaccgctcgggacgcattctgatcgagcttgccgacgac
ggcgccggcatcaaccgcgaaaaggtccgccagaaggcgatcgacaatgacctgatcccg
gccgacgcgaacctgtcggacgaggaaatcgacaacctgatcttcctgccgggcttctcg
acggccgacaagatctccgacatatcaggccgcggcgtcggcatggacgtcgtcaagcgc
tcgatccaggcgctcggcggtcgcatcaacatcacgtccaagccgggccacggctcggtc
ttcaccatgagcctgccgctgacgctcgccgttctcgacggcatggtggtcactgtcgcc
ggccagacgctggtcgtgccgctgaccgcgatcgtcgaaaccctgcagccggaagctgcc
gcgatccactccttcggcgccaaccaccggctgatctcgatccgcaactcgttctgccca
ctggtcgatgtcggccgcatcctgaacttccgggcaacccaggccaaccccgtcgaaggt
gtggcgctcctggtggaatcggagggcggcggccagcgcgccctgatggtcgatgccatc
cagggtcagcgccaggtggtcatcaagagcctggaggccaactacacccatgtgcccggc
atcgccgccgccaccattctcggcgacggccgcgtggctctcatccttgatgtcgacgcg
gtggtcggcgcctcgcgcggccactcgctcaaagcggaaatgtcgttagcagcggtaggg
taa

DBGET integrated database retrieval system