KEGG   Rhizobium etli CFN 42: RHE_CH00647Help
Entry
RHE_CH00647       CDS       T00317                                 

Definition
(GenBank) probable transcriptional regulator protein, LuxR family
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE HTH_10 Sigma70_r4_2 NUMOD1 HTH_38 HTH_23 TrmB HTH_40 Sigma70_r4 HTH_17 HTH_11 HTH_3 HTH_29 HTH_22
Motif
Other DBs
NCBI-ProteinID: ABC89463
RhizoBase: RHE_CH00647
UniProt: Q2KCH3
Position
669143..669847
Genome map
AA seq 234 aa AA seqDB search
MANFASVVAPALLPRDELVRRLHGVADTGRLQSGLRALTDYVGASHYLLARCDLIQESGL
DFIVSSDWPFDLVRDIANDLVSTYARSTELEKCMQVFQPNFALLPEGADVPEGASRQYCS
LTFNVGRSRLALMFLFGEGFILSPERLRDVGLLAGYIASFLRCGGAKVDRDFELTDRELE
CLFWIAEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttcgcgagcgtggtggcgccggctctcttgccgcgcgacgagctggttcgg
cgcctgcatggtgtcgccgacaccggcagattgcagtccggtctgcgcgccctgacggac
tatgtgggtgcctcacactatcttctggcgcgctgtgatctcatccaggaaagcggcctc
gatttcatcgtatcgtctgactggccgttcgatctggttagggatatcgccaatgatctc
gtcagcacctatgcccgctcgaccgagctggaaaaatgcatgcaggtcttccagccgaat
ttcgcgctgctgcccgaaggtgccgatgtgccggagggtgccagccgccagtattgctca
ttgaccttcaatgtcggccgctcgcgcctcgccttgatgttcctgttcggcgaaggcttc
atcctgtcgccggagcgcctgcgggacgtgggactgcttgccggctacatcgcgagcttc
cttcgctgcgggggcgcaaaggtcgaccgcgatttcgaactgactgaccgtgagctggaa
tgcctgttctggatcgcggagggcaagaccagcgacgagatcgcgatgattctcggaata
tcccgcaataccatcaacaactacatcaccagcgtaatgcgcaagacggcgaccaagacc
cggtcggaggccattgccttcgcggtccgcaacaatctcgtatag

DBGET integrated database retrieval system