KEGG   Rhizobium etli CFN 42: RHE_CH00648Help
Entry
RHE_CH00648       CDS       T00317                                 

Definition
(GenBank) probable transcriptional regulator protein, LuxR family
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE Sigma70_r4_2 Autoind_bind HTH_24 HTH_23 HTH_10 Sigma70_r4 HTH_40 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: ABC89464
RhizoBase: RHE_CH00648
UniProt: Q2KCH2
Position
669856..670602
Genome map
AA seq 248 aa AA seqDB search
MGHPSSRAMNGADPLRMVRVNRISSRSDLFPRLIAMQKLADAQGFAIYRVSGSGMPAKQR
LVCELENWGLSNVGFGKAFTDAYGDILLDHIEKSLLPLSWAGAHDRAAPGPADFSPFMTR
LKDGILPFSGLAFPVRLGAVGNGFILFTGDDIDPSSDTIVELHGRCCHVMMDLLSLDERR
SAAAEALSEREIACLQLAGDGRISEEIAEKLGLSVHTVNAYLGSATIKLDSVNRIQAIAK
AIRLGYIS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggggcatccatcaagcagggcgatgaacggcgccgatccgctgcgcatggtgcgggtg
aacaggatttccagccgttcggatctttttccgcggctgatcgcgatgcagaagctcgct
gacgctcaaggcttcgcgatctaccgtgtcagcggctcgggaatgccggcaaagcaacgc
cttgtctgtgagctcgagaactgggggctttcgaatgtcggtttcggcaaggccttcacg
gatgcctatggcgatattcttctcgaccatatcgaaaagtcgctgctgccgctttcatgg
gctggcgcgcacgaccgggcggcccccggtccggcagatttctcgcccttcatgacgcgc
ctgaaggatggaattctgcctttttccggcctcgcctttccggtgcggctcggcgccgtc
ggcaacggcttcatccttttcaccggcgatgatatcgatccttcaagtgatacgattgtc
gagctgcacggccgctgctgccacgtcatgatggatctgctctcgctcgacgaacgccgc
tcggccgccgccgaagcgctgagcgaacgagaaatcgcctgtctccagcttgccggcgat
ggccgcatcagcgaagagatcgccgaaaagctcggcctatccgtgcacacggtcaatgcc
tatctcggctcggcgaccatcaagctcgattccgtcaaccgcatccaggcgatcgccaag
gcgatccggctcggctacatcagctga

DBGET integrated database retrieval system