KEGG   Rhizobium etli CFN 42: RHE_CH00649Help
Entry
RHE_CH00649       CDS       T00317                                 

Definition
(GenBank) hypothetical conserved protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABC89465
RhizoBase: RHE_CH00649
UniProt: Q2KCH1
Position
complement(670651..671091)
Genome map
AA seq 146 aa AA seqDB search
MKKCPHSAQREKILADAISPVATELRLLDASDLISLLRFEYYGNLADLVASAAELFFHPG
TVNFGLGGNYALEWGGKPEVVLDLEIKPRGVTVYAQLTLAENHAGIEINHIAFEDPSSDP
DENTAFLEKSLRQSRYSVKPPHALAS
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatgccctcactctgcccagcgtgaaaagatcctcgcagacgcgatcagcccg
gtcgccaccgaactgcgccttctggatgcctctgacctcatttcactgctgcgcttcgag
tattacggcaatctggccgatctcgtcgcttcggcggcggagcttttctttcatccgggc
acggtcaatttcggcctgggcggaaactacgcgctggaatggggcggcaagcccgaagtc
gttctcgacctggaaatcaagccgcggggcgtcaccgtctatgcccagctcactcttgcc
gaaaatcatgccggcatcgaaatcaaccacatcgccttcgaggacccctcctccgatccc
gacgagaacactgcctttctggaaaagagccttcggcaatcccgctacagcgtgaaaccg
ccgcacgcactcgccagctga

DBGET integrated database retrieval system