KEGG   Rhizobium etli CFN 42: RHE_CH00653Help
Entry
RHE_CH00653       CDS       T00317                                 

Gene name
fliM
Definition
(GenBank) flagellar C-ring protein
  KO
K02416  flagellar motor switch protein FliM
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02030  Bacterial chemotaxis
ret02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    RHE_CH00653 (fliM)
   02040 Flagellar assembly
    RHE_CH00653 (fliM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ret02035]
    RHE_CH00653 (fliM)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   C-ring
    RHE_CH00653 (fliM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliMN_C
Motif
Other DBs
NCBI-ProteinID: ABC89469
RhizoBase: RHE_CH00653
UniProt: Q2KCG7
Position
complement(674113..675063)
Genome map
AA seq 316 aa AA seqDB search
MTMSDASHDKPAMDPALLAKLTGGLGDRGRVAKICSAFGDVYGEFLPDIIKSETGLDVTV
SYLGCEIGYKNHLVDDLSHNVTLVDATLRNWSQNVTLACGNGFVITLMEHLLGATADTIE
EPAERLLSVIELDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHDARPRPAEDKPDEF
AAAINMSITLAGIVSEFSLIIPQTALLKTKVTPPKPKRQTGGNSPEWTEQLGDQVRRSHV
TLEAKIRLQDLTLRTISKLMAGDVIPFHDSGDVRVEVSANSKELYICEFGRSGENYMVRV
KDTMNSDDELIRHLMN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgagcgatgcttcgcatgacaaaccggcaatggatcccgcccttctcgccaag
ctgaccggcgggctcggagacagaggcagggtcgcaaagatctgcagcgccttcggagat
gtctacggcgagttccttcccgacatcatcaaaagcgagaccggcctcgacgtgaccgtc
agctatctcggctgcgagatcggctacaagaaccacctggtggacgacctcagccataac
gtcacgcttgtcgacgcgacgctgcgcaactggtctcagaacgtcacgcttgcctgcggc
aacggtttcgtcatcacgctgatggaacacctgctcggcgccaccgccgatacgatcgag
gagccggccgagcggctgctctcggtcatcgaactcgatctggcagtcatggtcttcgac
aagatcgccaaggtgctgcgctcggcggtgaacgcaccgggcggtttcgagcccagtctt
tcggccccgcacgcccatgacgcccgcccccggccggcggaggacaagccggacgaattt
gccgcagccatcaacatgtcgatcacgctcgccggcattgtttcggaattctcactgatc
attccgcagacggcgctgctcaagaccaaggtgacgccgccgaaaccgaagcgccagacc
ggcggcaattcaccggagtggaccgaacagctcggcgaccaggtccgccgctcgcatgtc
acgctcgaggccaagatcaggctacaggacctgacgctgcgcaccatatcgaagctgatg
gccggcgacgtcatcccgttccacgacagcggcgacgtacgcgtcgaggtcagcgccaac
agcaaggaattgtatatatgcgagttcgggcgttctggcgaaaactatatggtccgcgtc
aaggatacgatgaactcggatgacgaactcatccgtcatttaatgaattga

DBGET integrated database retrieval system