KEGG   Rhizobium etli CFN 42: RHE_CH00654Help
Entry
RHE_CH00654       CDS       T00317                                 

Gene name
motA
Definition
(GenBank) chemotaxis motility protein
  KO
K02556  chemotaxis protein MotA
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02020  Two-component system
ret02030  Bacterial chemotaxis
ret02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RHE_CH00654 (motA)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    RHE_CH00654 (motA)
   02040 Flagellar assembly
    RHE_CH00654 (motA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ret02000]
    RHE_CH00654 (motA)
   02035 Bacterial motility proteins [BR:ret02035]
    RHE_CH00654 (motA)
Transporters [BR:ret02000]
 Other Transporters
  Pores ion channels [TC:1]
   RHE_CH00654 (motA)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    RHE_CH00654 (motA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB ArsP_1
Motif
Other DBs
NCBI-ProteinID: ABC89470
RhizoBase: RHE_CH00654
UniProt: Q2KCG6
Position
complement(675064..675798)
Genome map
AA seq 244 aa AA seqDB search
MANPMKVVKDSGKALAEAFKHAVPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNPAE
STIFQQAPTVLKNKELTAFICDYVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYHAIQ
IMGDSFPAIGIVAAVLGVIKAMAHINDSPEVLGHLIGSALVGTFLGILLSYCVCSPLVSQ
IKVVRNKQHRLYVIVKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGE
NKAA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacccgatgaaggtggtgaaggattccggcaaggcgctggcagaagccttcaag
cacgcggtgccgaaggagcgcaattatctcgatacgctcggcgtactctactcgctgatg
cgcgacctgcgcaccaaatcgcgaaacgaaatcgaagcccatatcgacaatcctgccgaa
tcgacgatcttccagcaggctccgacggttctgaagaacaaggaactgacggcgttcatc
tgcgattacgtgcgcctgatcattatcgggaacgcccgtagccacgaaatcgaagcgctg
atggacgaagagctcaacaccatcatgcacgacaagatgaagccctatcacgcgattcag
atcatgggcgattccttcccggcgatcggtatcgtcgcggccgttctcggcgtcatcaag
gcgatggctcacatcaacgattcacccgaggtgctcggccatctgatcggctcggcgctt
gtcggcaccttcctcggcattctcctgtcctattgcgtctgctcaccgctggtgtctcag
atcaaggtcgtccgcaacaagcagcatcgcctctatgtcatcgtcaagcagacgctgctt
gcctatatgaacggctcggttccgcaggtcgctctcgaatacggccgcaagacgatctcg
gcctacgaacgtccttccatcgacgcagtcgaacaggaaatgatgaacccaggcggcgaa
aacaaggcggcttaa

DBGET integrated database retrieval system