KEGG   Rhizobium etli CFN 42: RHE_CH00656Help
Entry
RHE_CH00656       CDS       T00317                                 

Gene name
fliI
Definition
(GenBank) H(+)-transporting ATP synthase, flagellum-specific protein
  KO
K02412  flagellum-specific ATP synthase [EC:3.6.3.14]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    RHE_CH00656 (fliI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ret02044]
    RHE_CH00656 (fliI)
   02035 Bacterial motility proteins [BR:ret02035]
    RHE_CH00656 (fliI)
Enzymes [BR:ret01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     RHE_CH00656 (fliI)
Secretion system [BR:ret02044]
 Type III secretion system
  Flagellar export apparatus
   RHE_CH00656 (fliI)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    RHE_CH00656 (fliI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ABC_tran RsgA_GTPase DUF87
Motif
Other DBs
NCBI-ProteinID: ABC89472
RhizoBase: RHE_CH00656
UniProt: Q2KCG4
Position
676928..678325
Genome map
AA seq 465 aa AA seqDB search
MSTTLLSEDGLSPKLVHLAGLVDRYASPEFAVAHGGRVQTIAAGHYTVRGLSRHVRLGEF
VAHKSATGIHLGEVVRVEPDLIYVCPIEPGEPIGIHDTVIRKGAFRISPSDSWCGRTVNS
LCEPIDGLGPIAAGLDRRSISNTAPPSMTRQRVATGFKTGVRAIDIFSPLCLGQRLGIFA
GSGVGKSTLLSMLARADAFDKVVIALVGERGREVREFIEDTLGSDMKKAIAVVATSDESP
MLRKMAPLTAITIAEHFRDKGENVLFIVDSVTRFAHAIREVATASGEPPIARGYPASVFT
ELPRLLERAGPGPEGAGTITAIISILVDGDNHNDPIADSTRGILDGHIVLQRSLAEEGRY
PPIDPLASISRLARKAWTPDQEKLVSRLKVLIHRFEETRDLRLIGGYRQGADPDLDMAVK
QVPIIYDVLKQAPGDRESVDAFADLAGALKAAAGMGNQGAPMQRR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacgctactgtccgaagacggcctttccccgaagctggtgcatctggcgggt
ctcgtcgaccgatacgcatcgccggaattcgccgtcgctcatggcggtcgcgtccagacc
atcgctgccggccactacacggtccgcggtctctcccgtcacgttcgtctcggcgaattc
gtcgcccataaatcggcgaccggcatccatctcggcgaggtcgtgcgtgtcgagccggac
ctgatctatgtctgcccgatcgaaccgggtgagccgatcggcatccatgacacggtcatt
cgcaagggcgccttccgcatttcgccgtccgacagctggtgcgggcgcacggtcaattcg
ctttgtgagccgatcgacgggctgggtccgatcgccgcgggactcgatcgccgctcgatt
tccaacaccgcgccgccctcgatgacgcgccagcgcgtggcgaccggcttcaagaccggc
gtacgcgcgatcgacatcttctctccgctctgcctcggccagcgtctcggcatctttgcc
ggctccggcgtcggcaagtcgacgcttctgtccatgcttgcccgcgccgatgccttcgac
aaggtggtgatcgcgctcgtcggcgaacgcggccgcgaggtgcgcgagttcatcgaggat
acgctcggcagcgatatgaagaaggcgattgccgtcgtcgcgaccagcgacgaaagcccg
atgctgcgcaagatggcgccgctgacggcgatcaccattgccgagcatttccgcgacaag
ggcgagaacgtccttttcatcgtcgacagcgtcacccgtttcgcccatgcgatccgcgaa
gtggcaaccgcctccggcgagccgccgatcgcacgcggttaccccgcgtcggtcttcacc
gaactgccgcgcctgctcgagcgcgccggtcccggccccgagggcgccggcacgatcacc
gcgatcatctcaatcctcgtcgacggcgacaaccacaacgacccgatcgccgattcgacg
cgcggcatccttgacggccatatcgtcctgcagcgcagcctcgccgaagaggggcgttat
ccgccgatcgatccgctcgcctcgatctcgcgtcttgcccgaaaggcctggacgccggat
caggaaaagctggtgtcgcggctgaaagtgctgatccaccgcttcgaggagacgcgggac
ctgcgcctgatcggcggttaccgtcagggcgccgatcccgatctcgacatggcggtcaag
caggtccccatcatttacgacgtcctgaaacaggcgccgggcgatcgtgagtcggtcgac
gcctttgctgacctcgccggcgcgctgaaggccgcagccggcatgggcaatcagggcgca
cccatgcagaggagatag

DBGET integrated database retrieval system