KEGG   Rhizobium etli CFN 42: RHE_CH00658Help
Entry
RHE_CH00658       CDS       T00317                                 

Gene name
flgB
Definition
(GenBank) flagellar basal-body rod protein
  KO
K02387  flagellar basal-body rod protein FlgB
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    RHE_CH00658 (flgB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ret02035]
    RHE_CH00658 (flgB)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    RHE_CH00658 (flgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bb_rod
Motif
Other DBs
NCBI-ProteinID: ABC89474
RhizoBase: RHE_CH00658
UniProt: Q2KCG2
Position
679032..679424
Genome map
AA seq 130 aa AA seqDB search
MQPIQLFDLASRQAEWLTIRQQVVAGNIANANTPKFRAKDVTPFDAVLDRSDITMARTNP
AHFSGNDFSDSGDIDVKEAALDQEIGIQESGNTVGLAEELSKSGDIKRQYDLNTSLVSSF
NRMMLMTVRK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgatccaacttttcgacttggcttcgcgacaggcggaatggctgacgatccgt
cagcaggttgttgccggcaacatcgcgaatgccaatactccgaaattccgcgccaaagac
gtcacgcccttcgatgccgtgctggacagatccgacatcaccatggcgcgcaccaatcca
gcgcatttcagcggcaacgatttcagcgacagcggcgatatcgacgtcaaggaagcggcc
ctcgaccaggagatcggcattcaagaatccggcaacaccgtcggtttggccgaggagctt
tccaagtcgggtgacatcaagcgccagtacgatttgaacacctcgctggtcagctccttc
aaccgtatgatgttgatgacggtcaggaagtaa

DBGET integrated database retrieval system