KEGG   Rhizobium etli CFN 42: RHE_CH00663Help
Entry
RHE_CH00663       CDS       T00317                                 

Gene name
flgI
Definition
(GenBank) flagellar basal-body P-ring protein
  KO
K02394  flagellar P-ring protein precursor FlgI
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    RHE_CH00663 (flgI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ret02035]
    RHE_CH00663 (flgI)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   M,S,P and L rings
    RHE_CH00663 (flgI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgI
Motif
Other DBs
NCBI-ProteinID: ABC89479
RhizoBase: RHE_CH00663
UniProt: Q2KCF7
Position
681495..682616
Genome map
AA seq 373 aa AA seqDB search
MKLFFRIVTLVAVVAMSLADMAPAWALTSRIKDIASLQAGRDNQLIGYGLIVGLQGTGDG
FRSSPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPFASPGSRLDVTVSSLGD
ATSLRGGTLVMTSLSGADGQIYAVAQGSVIVSGFQAQGQAATVTEGVTTAGRVPGGAIIE
RELPSHFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGGPVAEAKDSQEVVIQKPRT
ADLTRLMADVENLIVETDTPAKVVINERTGTIVIGSDVRVSPVAVSYGTLTVQVTETPQI
IQPEPFSRGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLVAGLNNIGVKPDGIIAILQGI
KSAGALQAELVLQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttcttccgtatcgtcacccttgttgcggtcgtcgccatgagtttggccgac
atggcgcctgcctgggcgctgacgtcccgcatcaaggatatcgcttcgcttcaggccggc
cgcgataaccagctgatcgggtacggtctcatcgtcggcctgcaggggaccggcgacggc
ttccgttcctcgcccttcaccgagcagtcgatgcgggcgatgctccagaatctcggtatc
tcgacacagggcggccagtccaatgccaagaacaccgcggccgtgatggtcaccgccaac
ctgccgcccttcgcaagccccggcagccgtctcgatgttacggtgagctcgctcggcgat
gcgacttcgctgcgtggcggcacgctcgtcatgacctccctttccggcgccgacggccag
atctacgctgtcgcccagggctccgtcatcgtctccggctttcaggcgcagggccaggcg
gcgaccgtgaccgaaggcgtcaccaccgccggccgcgtgcccggcggcgcgatcatcgaa
cgcgaactgccgtcccacttcaaggattcagtcaatctcgtcctgcagctgcgcaatcca
gacttctcgaccgcgatccgcattgccgacatcgtcaatggctatgcctccgcgcgcttc
ggcggcccggtcgccgaagccaaggattcgcaggaagtggtgatccagaaaccgcgcact
gccgatctcacccggctgatggccgacgtcgaaaacctcatcgtcgaaaccgatacgccg
gccaaggttgtcatcaacgagcgcaccggaacgatcgtcatcggctccgatgtccgcgtc
tcgccggtcgccgtcagctacggcactctgacggttcaggtcaccgagacgccgcagatc
atccaacccgaacccttctcgcgcgggcggaccgccgttcagccgcagaccgatatcgcg
gctgagcaaaccggtgggcgcgttgccatcatcgacggtcccgacctcaggacccttgtc
gccggtctcaacaatatcggcgtgaaaccggatgggatcatcgccattctccagggcatc
aagtcggcgggtgccctgcaggcggagcttgtgctgcaatga

DBGET integrated database retrieval system