KEGG   Rhizobium etli CFN 42: RHE_CH00665Help
Entry
RHE_CH00665       CDS       T00317                                 

Gene name
flgH
Definition
(GenBank) flagellar L-ring protein
  KO
K02393  flagellar L-ring protein precursor FlgH
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    RHE_CH00665 (flgH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ret02035]
    RHE_CH00665 (flgH)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   M,S,P and L rings
    RHE_CH00665 (flgH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgH MLTD_N Bactofilin PNGaseA
Motif
Other DBs
NCBI-ProteinID: ABC89481
RhizoBase: RHE_CH00665
UniProt: Q2KCF5
Position
683149..683865
Genome map
AA seq 238 aa AA seqDB search
MNMRFPAAIAALALLAGCQSPTAVSEIGRAPAMSPIGSGLAYGQTPQMALYPKQPRAVAQ
GYSLWSDSQAALFKDARALNVGDILTVDIQINDKASFDNETNRSRKNSSGMNWDVNAQIF
GWTPESKTDLTYGSDTSTDGKGKIERTDKLTLLVAAVVTGILENGNLVISGSQEVRLNQE
LRILNVAGIVRPQDVNAENQISYDKIAEARISYGGRGRLMEVQQPPRGQQAVDLFSPL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcgtttcccggccgcgatcgccgccctcgcactccttgcgggctgccagtct
ccgacggcagtcagcgagatcggccgtgcgcccgccatgagcccgatcggcagcggcctt
gcctatggccagaccccgcagatggcgctctatccgaagcagccgcgcgccgtggcgcag
ggctattcgctctggagcgattcgcaggccgcgctcttcaaggatgcgcgtgctttgaac
gtcggcgacatcctgaccgtcgacatccagatcaatgacaaggcctccttcgacaacgag
accaaccgcagccgcaagaactcgagcggcatgaactgggacgtcaacgcccagatcttc
ggctggaccccggaatcgaagaccgacctgacctacggctcggataccagcaccgacggc
aagggcaagatcgagcgcaccgacaagctgacccttcttgttgcggccgtcgtcaccggc
attctcgaaaacggcaacctcgtcatttcgggttcgcaggaagtccgtctgaaccaggag
ctgcgcatcctgaacgtcgccggtatcgtccgtccgcaggacgtcaacgccgaaaaccag
atctcctacgacaagatcgccgaagcccgcatctcctatggtggccgcggccgcctgatg
gaagtgcagcagcctccgcgcggccagcaggccgtcgatcttttctcgccgctttga

DBGET integrated database retrieval system